SecReT6
Protein ID: 119385186
SecReT6 ID159
T6SS typei3
Gene symbol-
Locus tagPden_2459
StrainParacoccus denitrificans PD1222
Repliconchromosome 1 [GenBank: NC_008686] [Browse all T6SS(s) in this replicon]
Location [Strand]2470233..2470826 [+]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDA1B4V2
KEGG IDpde:Pden_2459
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 6.00E-18, Aligned region: 95..189
Protein Sequence: 197 a.a.     [Download]
>gi|119385186|ref|YP_916242.1| unnamed protein product [Paracoccus denitrificans PD1222]
MVIPVLRTGLAILCGICLLAGSAQGQDLTEEQILQRFEAQREMYRATLQGQKTRGLDMISVTQGGEQGAT
EATEPSGTVVFGEFAPELQVNIAIRFAFDSASIAPDQRPALERMCSAMRQSDVGLFRIVGHTDAKGSDSY
NETLSKLRAEEVRRWLVQDCGITASRLEALGMGKRFLANPADPAAAENRRVEFQALS
 
Nucleotide Sequence: 594 bp     [Download]
>gi|119382757|ref|NC_008686.1|:2470233-2470826 Paracoccus denitrificans PD1222 chromosome 1, complete sequence
ATGGTGATTCCCGTGCTGCGGACTGGTCTAGCCATATTGTGCGGCATTTGCCTTCTGGCCGGCTCTGCCC
AGGGCCAGGACTTGACCGAAGAGCAGATCCTGCAACGCTTCGAGGCGCAGCGCGAGATGTATCGCGCCAC
CCTTCAGGGCCAGAAGACGCGCGGGCTGGACATGATCTCGGTCACGCAGGGCGGCGAACAGGGCGCGACC
GAGGCGACGGAGCCGTCCGGCACCGTGGTCTTTGGCGAATTCGCGCCCGAGCTTCAGGTCAATATCGCGA
TCCGCTTCGCCTTCGATTCGGCCAGCATCGCGCCGGACCAGCGCCCGGCCCTGGAAAGGATGTGCTCGGC
GATGCGGCAATCGGATGTCGGGCTGTTCCGCATCGTCGGCCATACCGACGCAAAAGGCAGCGACAGTTAT
AACGAAACCCTTTCGAAGCTGCGCGCCGAAGAGGTGCGCCGCTGGCTGGTCCAGGATTGCGGCATCACCG
CCTCGCGGCTGGAGGCGCTTGGCATGGGCAAACGCTTCCTCGCCAATCCCGCCGATCCGGCGGCCGCCGA
AAACCGCCGGGTCGAGTTTCAGGCATTGAGCTGA