SecReT6
Protein ID: 119897588
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1297
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1413077..1413520 [-]
Producthypothetical protein
NoteTssE
UniProt IDA1K509
KEGG IDazo:azo1297
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.10E-19, Aligned region: 21..127
Protein Sequence: 147 a.a.     [Download]
>gi|119897588|ref|YP_932801.1| hypothetical protein azo1297 [Azoarcus sp. BH72]
MPSLIDRLMATGGGAGTTAPTADTLRTALARDLEALLNTRATCALDATSEFPRASGSLLTFGLPDFDSLN
LHGAPDRRRLTDEVRRAIERNEPRLARVQVSMVASPANGQPIRLRIAAELRSDARRRTPVSFDATLQLSS
NAYRVKP
 
Nucleotide Sequence: 444 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c1413520-1413077 Azoarcus sp. BH72 chromosome, complete genome
ATGCCCTCGCTGATCGATCGCTTGATGGCCACGGGCGGCGGCGCCGGAACCACCGCTCCGACGGCAGACA
CGCTGCGGACGGCCCTCGCGCGCGATCTCGAAGCCCTGCTCAACACCCGGGCGACCTGCGCGCTCGACGC
CACATCGGAATTCCCGCGTGCCAGCGGATCGCTACTGACCTTCGGGCTGCCCGACTTCGACAGTCTCAAC
CTCCACGGCGCCCCGGACCGGCGCCGGCTGACCGACGAAGTCCGGCGGGCCATAGAACGCAACGAGCCCC
GGCTCGCACGCGTCCAGGTCAGCATGGTGGCGTCACCCGCAAATGGCCAGCCGATCCGCTTGCGCATCGC
CGCGGAACTGCGCAGCGACGCGCGCCGACGCACGCCGGTCAGCTTCGACGCCACCCTCCAGCTGTCTTCG
AATGCCTACCGCGTAAAGCCCTGA