SecReT6
Protein ID: 119897589
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1298
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1413533..1414231 [-]
Producthypothetical protein
NoteTssL
UniProt IDA1K510
KEGG IDazo:azo1298
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-54, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|119897589|ref|YP_932802.1| hypothetical protein azo1298 [Azoarcus sp. BH72]
MAIASTTSAAAVPDRSPGATPLIELLDDGFHLLALLRQRARPRHYDSFVDRVLALLRDFERNALAAGKAP
PEIEQARYAFCAALDEVVLSSDFPLRAEWERQPLQLRLFGEHLAGEGFFERLAALRLAPHENIECLEVFH
ACLLLGFRGKYLLDDSDRIRYLQRTLAQELQRVRGDPQTPPALWKLPEEELTPPRPGLPTRFYAGILLVV
GLAFFALYQVLLDQRAQALFGV
 
Nucleotide Sequence: 699 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c1414231-1413533 Azoarcus sp. BH72 chromosome, complete genome
TTGGCAATTGCCTCCACCACGTCCGCTGCCGCGGTTCCCGACCGCAGCCCTGGCGCAACGCCGCTGATCG
AACTGCTGGACGACGGATTTCATCTGCTGGCGCTGTTGCGCCAGCGAGCCCGTCCCCGTCACTACGACAG
CTTTGTCGACCGGGTGCTGGCGCTGCTGCGCGACTTCGAGCGAAACGCACTGGCAGCGGGAAAAGCGCCG
CCGGAAATCGAGCAGGCGCGCTACGCGTTCTGCGCGGCGCTCGACGAGGTCGTGCTGTCGAGCGACTTCC
CGCTACGGGCCGAGTGGGAAAGGCAACCCCTTCAACTGCGGCTGTTCGGTGAACACCTGGCTGGGGAGGG
CTTCTTCGAACGCCTCGCCGCGTTACGCCTTGCTCCGCACGAGAACATCGAATGCCTGGAGGTGTTTCAT
GCCTGCCTGCTACTCGGTTTTCGCGGCAAGTACCTGCTCGACGACAGCGACCGCATCCGCTACCTGCAGC
GCACACTCGCGCAGGAACTGCAACGCGTTCGCGGCGACCCGCAAACGCCCCCCGCGCTGTGGAAGCTGCC
AGAGGAGGAACTGACTCCGCCGCGCCCGGGGTTACCGACCCGGTTTTACGCCGGCATCCTGCTGGTGGTG
GGCCTCGCCTTCTTCGCCCTTTACCAGGTGCTGCTGGACCAGCGCGCGCAAGCGCTGTTCGGCGTCTGA