SecReT6
Protein ID: 119897590
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1299
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1414245..1415591 [-]
Producthypothetical protein
NoteTssK
UniProt IDA1K511
KEGG IDazo:azo1299
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-123, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|119897590|ref|YP_932803.1| hypothetical protein azo1299 [Azoarcus sp. BH72]
MLKTRRVLWGEGMFLRPQHFQQQALQHEAALAGSLQGLYRHAWGARAVVVDETGLAAGVLRFDNLSIWFR
DGTRYCAPEHDPLPPSRDLAGISADGNTVLVYACLPELHPHGGNVGDHERNPAQRVRFLKRHAASCDLYS
GALEAELTLLDLNVQLRLEDENRDGFESLPVARLRRDGQGQWSVDASYLPPSLDLALDGAAARLLRRLLD
ILQVKSGLLAARQREHATHLLEYGSSDIAAFWLLHTVNRNYARLQHLERARPLHPEALYLALAELYGELV
TFSRSHTLADLPPYRHENLAGSLTPLDDRIRDLLDTVVSNRHQVITLRNPKPSFHIGHLDNERLLEADFY
LSVQSSMPAAAVIDAVPSKLKIGAPDDVEKILNSAVRGVAVVHATQTPSSVPVRIGNHYFALEPNSEVYQ
RMVQARSVCVYVPQTLADLKLELIAVFR
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c1415591-1414245 Azoarcus sp. BH72 chromosome, complete genome
ATGCTGAAGACTCGACGTGTGCTGTGGGGGGAAGGCATGTTCCTGCGCCCGCAGCACTTCCAGCAGCAGG
CGCTGCAGCATGAAGCGGCGCTGGCAGGAAGCCTCCAGGGCCTGTACCGCCATGCGTGGGGCGCCCGGGC
AGTCGTGGTCGACGAGACCGGGCTGGCGGCAGGTGTGCTGCGATTCGACAATCTCAGCATCTGGTTCCGC
GACGGCACCCGCTACTGCGCACCGGAACATGATCCGCTCCCACCCTCGCGCGACCTCGCAGGCATTTCGG
CCGATGGAAATACCGTCCTGGTGTACGCCTGCCTTCCGGAGTTGCACCCCCACGGCGGCAACGTGGGCGA
CCACGAGCGCAACCCTGCTCAGCGCGTGCGCTTTCTCAAACGCCACGCCGCCAGTTGTGATTTGTATTCC
GGCGCACTCGAAGCCGAACTCACGCTGCTCGACCTCAACGTCCAGCTTCGTCTGGAAGACGAAAACCGCG
ATGGCTTCGAGTCGCTGCCGGTTGCACGCCTGCGGCGAGATGGACAGGGGCAATGGTCGGTCGATGCGTC
CTATCTTCCCCCCAGCCTGGATCTGGCCCTGGATGGCGCCGCGGCCCGCCTGCTGCGCCGCCTGCTCGAC
ATCCTCCAGGTCAAGAGCGGCCTGCTGGCAGCACGTCAGCGGGAACACGCCACCCATCTGCTGGAATACG
GCAGCAGCGACATTGCCGCGTTCTGGCTCCTGCACACGGTGAACCGGAACTACGCCCGTCTGCAGCATCT
CGAGCGGGCCCGGCCGCTGCATCCCGAAGCGCTGTACCTTGCGCTGGCCGAGCTGTACGGCGAACTGGTC
ACCTTCTCCCGCAGCCACACCCTGGCCGACCTCCCTCCCTACCGCCACGAGAACCTCGCCGGCTCGTTGA
CGCCCCTCGATGATCGGATCCGCGACCTGCTCGATACCGTGGTTTCGAATCGGCACCAAGTCATCACGCT
GCGCAATCCCAAGCCTTCGTTCCACATCGGCCATCTGGACAACGAACGCTTGCTGGAGGCGGACTTCTAT
CTATCCGTGCAATCCTCCATGCCGGCTGCTGCGGTCATTGACGCCGTGCCGTCAAAGCTGAAGATCGGCG
CCCCGGACGACGTCGAGAAGATACTGAACTCGGCGGTACGCGGCGTTGCAGTCGTCCACGCCACGCAGAC
CCCGTCATCGGTCCCGGTTCGTATCGGCAACCACTATTTCGCACTTGAACCGAACAGCGAGGTGTACCAG
CGCATGGTCCAGGCGCGCTCCGTCTGCGTCTATGTGCCGCAAACCCTCGCTGACCTCAAGCTGGAACTGA
TTGCGGTCTTCCGCTGA