SecReT6
Protein ID: 119897591
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1300
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1415603..1416217 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA1K512
KEGG IDazo:azo1300
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-28, Aligned region: 45..176
Protein Sequence: 204 a.a.     [Download]
>gi|119897591|ref|YP_932804.1| hypothetical protein azo1300 [Azoarcus sp. BH72]
MNFLDWPALPIFQGCKARRRPSSTRAFIARVPSPAGRILYVCASLFLAGCAVTSTPPRLVLSAETALNRD
GSGASLSVVVRTYQLRDRRAFDRLGFDVFGGGRSDTEIFGAELLSSQEFVLTPGARLSDALPLHAEASYV
GIVGLFMQPDGELWRGLVDAQATRKLGLQVRLQECYLRIESPAPLKIPGQTEGRTPSCPAGRPS
 
Nucleotide Sequence: 615 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c1416217-1415603 Azoarcus sp. BH72 chromosome, complete genome
ATGAATTTTCTGGATTGGCCGGCGTTGCCCATTTTCCAAGGCTGCAAGGCACGACGGCGGCCCTCGTCCA
CGCGGGCTTTCATTGCCCGCGTACCGTCGCCGGCAGGTCGCATCCTGTACGTGTGTGCCTCGCTGTTTCT
CGCGGGATGCGCAGTCACGAGCACACCGCCCCGGCTCGTTCTCTCGGCCGAAACCGCGCTGAATCGGGAT
GGCAGCGGGGCGTCGCTATCGGTCGTGGTACGTACCTACCAATTGCGCGACCGGCGCGCCTTCGATCGAC
TTGGTTTCGACGTATTCGGAGGCGGCAGGTCGGACACGGAGATATTCGGCGCTGAACTCCTGTCTTCGCA
GGAGTTCGTCCTCACGCCGGGCGCACGTCTTTCAGATGCCCTCCCGCTTCACGCAGAGGCCAGCTATGTC
GGCATCGTCGGGCTGTTCATGCAGCCCGACGGAGAGCTGTGGCGGGGCCTGGTCGATGCCCAAGCGACCC
GTAAGCTAGGGCTGCAGGTACGCCTGCAGGAGTGCTACCTGCGCATCGAAAGTCCCGCCCCATTGAAAAT
CCCCGGCCAGACAGAAGGGCGCACACCCAGTTGCCCCGCCGGCCGCCCCTCCTGA