SecReT6
Protein ID: 119897594
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1303
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1420836..1421360 [+]
Producthypothetical protein
NoteTssB
UniProt IDA1K515
KEGG IDazo:azo1303
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-56, Aligned region: 10..165
Protein Sequence: 174 a.a.     [Download]
>gi|119897594|ref|YP_932807.1| hypothetical protein azo1303 [Azoarcus sp. BH72]
MVRESTQKKLSRVRPPRVQITYDVEVGDAIETKELPFVLGVLGDYTGHAREQLPRLKERKFVAIDRDNFD
DVMKALAPRLGLRVPNRLSAEGGLLGVELGFAAMEDFEPQNVVAQFTPLRRLLEARQRLAELRNKLVGSE
RFEALLNEAVADRDALQALKGELDARGGMHDGAR
 
Nucleotide Sequence: 525 bp     [Download]
>gi|119896292|ref|NC_008702.1|:1420836-1421360 Azoarcus sp. BH72 chromosome, complete genome
ATGGTCCGAGAAAGTACCCAGAAGAAGCTGTCGCGCGTGCGTCCGCCCCGCGTGCAAATCACGTATGACG
TCGAGGTCGGAGATGCCATCGAAACCAAGGAGCTGCCTTTCGTACTGGGGGTGCTGGGCGACTACACCGG
GCATGCACGGGAGCAGCTACCCCGGCTCAAGGAAAGGAAGTTCGTCGCCATCGACCGCGACAACTTCGAC
GACGTCATGAAGGCGCTCGCCCCTCGGCTGGGGCTGCGGGTGCCCAACCGGCTGTCCGCCGAAGGCGGCC
TGCTCGGCGTAGAGCTGGGGTTCGCAGCGATGGAGGATTTCGAGCCGCAGAACGTGGTGGCGCAGTTCAC
CCCGCTGCGGCGCTTGCTCGAGGCGCGGCAGCGTTTGGCCGAACTGCGCAACAAGCTGGTGGGCAGCGAA
CGCTTCGAAGCCCTGCTCAACGAAGCCGTCGCTGACCGCGACGCCCTGCAGGCACTGAAGGGAGAACTGG
ACGCTCGCGGGGGGATGCATGACGGCGCGCGATGA