SecReT6
Protein ID: 119897595
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1304
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1421344..1422837 [+]
Producthypothetical protein
NoteTssC
UniProt IDA1K516
KEGG IDazo:azo1304
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-189, Aligned region: 70..493
Protein Sequence: 497 a.a.     [Download]
>gi|119897595|ref|YP_932808.1| hypothetical protein azo1304 [Azoarcus sp. BH72]
MTARDEHLVRTSASPQVEAEGAGLLDSLIARSRVAVDEAEHDRTRDLIGELVQEVMSGALPLTCDLAASI
DARIAELDELISAQLNEIMHDPEFQRLEGSWRGLKYLVDAAETGPMLKLRMLNVSKKELIKDFRQAAEFD
QGALFKKVYEEEYGTFGGAPFAALVGDYEFSRHPEDLYLLEELAHVAAAAHAPFIGAVAPAMFGLDNFAE
LGRPRDLSRIFETVEYAKWKSFRASDDSRYVGLVLPHVLGRLPYGRDTHPVDAFNFEEDVDGSDHAKYLW
TSAVYSYASRLTAAFAQFGWLAAIRGVEGGGLVEDLPLHTFRTDDGEIGAKCPTELAITDRNEKLLADLG
FIALTHCKNSDYAAFFSGQSVQRPRTYNTDAANANARLSAQLPYIFASSRIAHYLKAMMRDKVGSFASRQ
NVQDFLNAWLAQYVLLDDAASQEAKSKYPLREARVEVVEVPGRPGAYRAAAFLRPHFQLDELTISLRLVA
ELPQPAR
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|119896292|ref|NC_008702.1|:1421344-1422837 Azoarcus sp. BH72 chromosome, complete genome
ATGACGGCGCGCGATGAACACCTGGTGCGCACGAGCGCTTCTCCCCAGGTCGAGGCAGAGGGTGCCGGAC
TGCTGGATTCGCTGATCGCGCGCAGTCGGGTCGCGGTGGATGAGGCAGAGCACGACCGCACCCGCGACCT
CATCGGCGAACTCGTTCAGGAGGTCATGAGCGGGGCCCTGCCGCTGACCTGCGACCTTGCGGCATCGATC
GACGCCCGTATCGCCGAGCTGGATGAACTCATCTCGGCACAGCTCAACGAGATCATGCACGACCCCGAGT
TCCAGCGGCTTGAAGGAAGCTGGCGCGGGCTCAAGTACCTGGTCGACGCCGCAGAGACCGGGCCGATGCT
CAAGCTGCGCATGCTCAATGTGTCCAAGAAGGAGTTGATCAAGGACTTCCGCCAGGCGGCGGAGTTCGAT
CAGGGGGCCTTGTTCAAGAAGGTGTACGAGGAGGAGTACGGCACCTTCGGCGGCGCCCCCTTCGCGGCGC
TGGTCGGGGACTACGAGTTTTCCCGCCATCCCGAGGATCTCTATCTGCTCGAGGAACTGGCACACGTCGC
CGCCGCGGCGCACGCCCCGTTCATCGGGGCCGTGGCGCCGGCGATGTTCGGGCTGGACAACTTCGCCGAA
CTGGGCCGGCCGCGCGATCTCTCCCGGATCTTCGAAACCGTCGAGTACGCAAAGTGGAAGTCCTTCCGGG
CGAGCGACGATTCGCGCTATGTGGGGCTGGTACTGCCGCATGTGCTGGGGCGGCTGCCCTATGGGCGGGA
TACCCATCCGGTGGATGCGTTCAACTTCGAGGAGGACGTGGATGGCAGCGACCACGCCAAGTATCTGTGG
ACCAGCGCAGTCTATTCCTATGCGAGCCGCCTGACCGCTGCCTTTGCCCAGTTCGGCTGGCTTGCCGCTA
TACGGGGGGTTGAAGGGGGCGGGCTGGTTGAGGATCTGCCGCTCCATACCTTCCGTACCGACGACGGCGA
AATCGGCGCCAAGTGCCCGACCGAACTTGCCATAACGGACCGCAACGAAAAGCTGCTGGCCGACCTGGGG
TTCATCGCACTGACGCACTGCAAGAACAGCGACTACGCCGCGTTTTTCAGCGGCCAGTCGGTACAGCGTC
CGCGTACCTACAACACCGATGCCGCCAATGCCAATGCGCGCTTGTCGGCCCAACTGCCCTACATCTTTGC
CTCGTCGCGGATCGCGCATTACCTGAAGGCGATGATGCGCGACAAGGTGGGCAGTTTCGCCTCGCGCCAG
AATGTCCAGGACTTCCTCAACGCGTGGCTCGCGCAGTACGTGTTGCTCGACGACGCAGCCTCCCAGGAAG
CGAAGTCCAAGTACCCGCTGCGGGAGGCGCGGGTGGAGGTGGTCGAGGTGCCGGGGCGCCCCGGCGCCTA
CCGCGCAGCAGCCTTCCTGCGCCCCCATTTCCAGCTCGACGAACTGACGATTTCCCTGCGCCTGGTTGCG
GAGCTGCCCCAACCCGCGCGCTGA