SecReT6
Protein ID: 119897596
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1305
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1422881..1423378 [+]
Producthypothetical protein
NoteTssD
UniProt IDA1K517
KEGG IDazo:azo1305
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-49, Aligned region: 6..139
Protein Sequence: 165 a.a.     [Download]
>gi|119897596|ref|YP_932809.1| hypothetical protein azo1305 [Azoarcus sp. BH72]
MAFDAFLRIEGIPGESTDDKHQDWIEVLSFNHSMEQPASATASSVGGATAERVNHGSFEVTHLLDQASPK
IYDACCTGKHIKEVTLELCRAGGDKVKYMEVKLEQVVISKVVPAGAANDQGFPQEKISFSYGRIKWTYTR
QKRDDGTGGGNVSAGWDLTANKAVA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|119896292|ref|NC_008702.1|:1422881-1423378 Azoarcus sp. BH72 chromosome, complete genome
ATGGCATTCGACGCATTTCTCCGCATCGAGGGTATCCCCGGCGAGAGCACCGACGACAAGCACCAGGACT
GGATCGAGGTCCTGTCCTTCAACCACAGCATGGAGCAGCCGGCGTCCGCCACGGCCAGTTCGGTCGGCGG
CGCCACCGCGGAACGCGTCAATCACGGCAGTTTCGAGGTCACTCACCTGCTCGACCAGGCCAGCCCGAAG
ATCTACGACGCCTGCTGCACCGGCAAGCACATCAAGGAGGTCACGCTCGAGCTGTGCCGCGCAGGCGGTG
ACAAGGTGAAGTACATGGAGGTGAAGCTCGAGCAGGTCGTCATTTCCAAAGTCGTTCCCGCCGGCGCGGC
GAATGACCAGGGGTTCCCGCAGGAGAAGATCTCATTCAGCTACGGCCGTATCAAATGGACCTACACCCGC
CAGAAGCGCGACGACGGCACGGGCGGCGGAAACGTTAGCGCCGGTTGGGACCTGACCGCGAACAAGGCGG
TGGCGTGA