SecReT6
Protein ID: 119897597
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1306
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1423378..1423854 [+]
Producthypothetical protein
NoteTagL
UniProt IDA1K518
KEGG IDazo:azo1306
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.80E-06, Aligned region: 73..142
Pilus_CpaD [PF09476], Evalue: 0.00087, Aligned region: 21..157
Protein Sequence: 158 a.a.     [Download]
>gi|119897597|ref|YP_932810.1| hypothetical protein azo1306 [Azoarcus sp. BH72]
MALIGLSHRVRTRARGAAGALLVAVLLSACAGAPPQAEPAAEVEPLRPAPESPVVAPAGEPEPAVAGRHT
FRFDTLSVALSESEKVRVVTLAEQVRGARAVVVRGSCDRNAVGNAREAAIARALAVRHVLVENGVPAAKI
RTRYSTEDGTHAVVLRVN
 
Nucleotide Sequence: 477 bp     [Download]
>gi|119896292|ref|NC_008702.1|:1423378-1423854 Azoarcus sp. BH72 chromosome, complete genome
ATGGCGCTGATCGGCCTTTCGCACAGGGTGCGGACACGTGCGCGCGGCGCGGCCGGCGCGCTGCTGGTCG
CCGTCTTGCTGTCTGCGTGCGCGGGTGCGCCTCCGCAAGCGGAGCCCGCGGCCGAGGTGGAACCGCTGCG
CCCGGCGCCGGAGTCCCCGGTCGTCGCGCCCGCCGGTGAGCCCGAGCCTGCCGTCGCGGGCCGCCATACC
TTCCGTTTCGACACCTTGAGCGTGGCCCTGAGCGAGAGCGAAAAGGTCCGCGTTGTCACCCTTGCGGAGC
AGGTCCGCGGCGCGCGTGCGGTGGTCGTACGCGGCTCCTGCGATCGCAACGCGGTGGGAAACGCAAGGGA
AGCGGCGATTGCCCGTGCGCTGGCGGTGCGCCACGTGTTGGTGGAGAACGGCGTGCCAGCGGCAAAGATC
CGGACCCGCTATAGCACCGAGGATGGCACCCACGCGGTGGTGCTGCGCGTGAACTAG