SecReT6
Protein ID: 119897598
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1307
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1423911..1426628 [+]
ProductVgr related protein
NoteTssI
UniProt IDA1K519
KEGG IDazo:azo1307
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-64, Aligned region: 50..374
T6SS_Vgr [PF13296], Evalue: 3.80E-36, Aligned region: 545..653
T6SS_Vgr [PF13296], Evalue: 3.80E-36, Aligned region: 682..718
T6SS_Vgr [PF13296], Evalue: 3.80E-36, Aligned region: 749..765
T6SS_Vgr [PF13296], Evalue: 3.80E-36, Aligned region: 803..822
DUF2345 [PF10106], Evalue: 1.70E-35, Aligned region: 589..614
DUF2345 [PF10106], Evalue: 1.70E-35, Aligned region: 679..829
Phage_base_V [PF04717], Evalue: 1.10E-21, Aligned region: 428..526
Phage_base_V [PF04717], Evalue: 1.10E-21, Aligned region: 768..789
Protein Sequence: 905 a.a.     [Download]
>gi|119897598|ref|YP_932811.1| Vgr related protein [Azoarcus sp. BH72]
MTDSLRSAAADLLSVADAISFLPATRLVELRFAGGGPEGSPLIALSAYGEEGLNMCHRITVRCVAVDARI
ELITMLGLRAAIGIRTADGRERIRCGVVTAGVALGADGGFAAYEITVEPPLALLRHRWGSRVFQALTVPE
IVRALVEEHRGRNPIFNAGLGLRFDLQRRYECRSYCVQYHESDLEFIERLLAEEGIGWRFDHEEDAAGAG
PSTLLVLFDAADSLPPAEPPSVRFHRGNASETEDSLTSWSAQRSVGAGRTTLTSFDYKPAATTTARAEGV
EEDGGDATSLEQALEDFRPQTLHYAPTVDGLAAYAALRQQARDAERNTFEADGDARGLTAGAWFQLEGHP
RHEHEPGEERRFVVTRLTFVARSNLPVHSSLIDAAGEGRAWAGAGKTPYQIRLTAVRRGQASAGIFPPRR
DLRPTARGPQSAIVVGPHDEEVHTDEYGRIRIQFHWQRQEDHPDGGAAYDERSSCWVRVALPSAGIAWGH
QFIPRVGQEVLVDFLDGDIDRPVVTGVLGNGCHPPVRFSGVGALPANKALSGIKSREHGGAGFNELVFDD
TAGQLRARLSTEHAATQLNLGCLVHPRENGQATVRGDGAELRTDGAAAVRGARGVLVSAHGRPRAAGSQL
AREELMELLEQARELARTLSDYAGSHQGVPAESSGADALLQAVRQWDGDRAEGADRERGDGLVCAAAPEG
IVIATGATLISCAAEDHEVCASHQLRLTAGEGLVANAGAGIGLFAQSGDLRSIAHQGLHLTQAQQGDVVT
EAARNVRVSAAEGEVLISAPVIRLVAQDGSFLRLGGGIALGTEGAVQVKAARHSLGGPATDSIDLPVFDR
AGADQRFALLYPGAEGAEPQPAGGRRYEITLKDGRVVAGTADAEGRTDMLTSEAMQVAHIRVFDR
 
Nucleotide Sequence: 2718 bp     [Download]
>gi|119896292|ref|NC_008702.1|:1423911-1426628 Azoarcus sp. BH72 chromosome, complete genome
GTGACCGACTCGCTTCGATCCGCTGCCGCCGACCTGTTGTCGGTGGCAGACGCTATTTCATTCCTGCCGG
CGACGCGTCTGGTCGAACTGCGGTTCGCCGGTGGCGGCCCAGAAGGCAGCCCCTTGATCGCATTGAGTGC
CTATGGCGAGGAGGGGCTCAACATGTGCCACCGGATCACGGTGCGCTGCGTCGCCGTGGACGCACGGATC
GAGCTGATAACCATGCTCGGCCTGCGCGCGGCGATCGGGATCCGCACCGCGGACGGACGGGAGCGGATTC
GATGCGGGGTGGTGACCGCGGGGGTTGCACTCGGTGCCGACGGCGGCTTTGCAGCTTACGAGATCACGGT
GGAGCCGCCACTCGCGCTGTTGCGCCACCGGTGGGGCAGCAGGGTGTTTCAGGCGCTGACCGTGCCGGAG
ATCGTCCGGGCCCTGGTTGAGGAACACCGGGGTCGCAACCCCATCTTCAATGCCGGCCTGGGGCTACGCT
TCGATCTCCAGCGCCGCTACGAGTGCCGCTCCTACTGCGTGCAGTATCACGAGTCCGACCTCGAGTTCAT
CGAACGCCTGCTCGCGGAAGAGGGCATCGGCTGGCGCTTCGACCACGAAGAGGACGCAGCGGGGGCCGGG
CCCTCGACCCTGTTGGTGCTGTTTGACGCCGCAGACAGTCTCCCGCCCGCGGAGCCCCCATCGGTCCGCT
TCCACCGCGGCAACGCCAGCGAAACAGAGGACAGCCTCACCTCGTGGTCGGCCCAGCGCAGCGTCGGCGC
CGGGCGCACGACGCTGACCAGTTTCGACTACAAGCCCGCCGCTACTACCACCGCGCGTGCCGAGGGCGTG
GAAGAAGATGGGGGCGACGCCACTTCGCTCGAGCAGGCGCTGGAGGATTTCCGGCCGCAGACCCTGCACT
ATGCGCCCACGGTCGATGGCCTCGCCGCATACGCGGCACTCCGCCAGCAGGCGCGGGATGCGGAGCGCAA
TACCTTCGAGGCGGACGGGGATGCGCGTGGGCTGACGGCAGGGGCGTGGTTCCAGCTGGAGGGGCACCCG
CGCCACGAGCATGAACCGGGCGAAGAACGTCGCTTCGTGGTGACGCGCCTGACGTTCGTTGCGCGCAGCA
ATCTTCCCGTCCATTCGTCGCTGATCGACGCGGCGGGCGAGGGCCGCGCCTGGGCAGGGGCCGGAAAGAC
GCCTTATCAGATCCGGCTGACGGCGGTGCGTCGGGGGCAGGCGTCTGCCGGCATCTTTCCGCCGCGTCGC
GACCTGCGCCCCACCGCCCGCGGGCCTCAGAGCGCAATCGTGGTCGGGCCGCATGACGAAGAGGTTCACA
CCGACGAGTACGGCCGCATTCGCATCCAGTTCCACTGGCAGCGGCAGGAAGATCACCCGGACGGCGGAGC
CGCTTACGACGAGCGTTCCTCCTGCTGGGTGCGCGTCGCGCTGCCCAGCGCGGGCATCGCCTGGGGGCAT
CAGTTCATTCCGCGCGTCGGCCAGGAGGTCCTGGTGGATTTCCTTGACGGCGACATCGACCGGCCGGTGG
TGACCGGCGTGCTGGGCAACGGGTGTCACCCTCCGGTCCGCTTTTCCGGGGTCGGCGCGCTGCCCGCCAA
CAAGGCTCTGTCCGGGATCAAGTCGCGGGAGCACGGCGGCGCGGGCTTCAACGAGCTGGTGTTCGACGAC
ACGGCGGGGCAACTGCGGGCACGGCTGAGCACGGAACACGCAGCGACGCAGCTGAACCTCGGCTGCCTTG
TCCATCCCCGCGAAAACGGGCAGGCGACGGTCCGGGGTGACGGGGCAGAGCTGCGTACCGACGGCGCTGC
CGCGGTTCGGGGTGCCCGCGGCGTGCTGGTGAGTGCGCATGGACGGCCGCGCGCTGCCGGCAGCCAGCTG
GCACGGGAAGAGTTGATGGAACTGCTGGAGCAGGCGCGCGAACTCGCGCGCACGCTGTCCGATTACGCGG
GCAGCCACCAGGGCGTTCCTGCCGAGAGCAGTGGCGCCGACGCGCTGCTGCAGGCAGTGCGTCAATGGGA
TGGGGATCGCGCCGAGGGTGCAGACCGGGAGCGCGGTGACGGACTCGTTTGCGCGGCCGCGCCCGAGGGG
ATCGTGATTGCGACCGGTGCGACGCTGATCAGTTGCGCGGCCGAGGATCACGAGGTCTGTGCCAGCCACC
AGCTCCGGCTGACCGCAGGGGAAGGCTTGGTAGCGAATGCGGGCGCCGGCATCGGGCTCTTCGCCCAGTC
GGGCGACCTGCGCTCGATCGCACATCAGGGCCTGCATCTGACCCAGGCCCAGCAGGGCGACGTGGTGACC
GAAGCCGCCCGCAACGTCCGCGTTTCCGCGGCCGAAGGTGAAGTCCTGATCAGCGCGCCGGTAATCCGGC
TCGTGGCCCAGGACGGCTCCTTCCTCCGGTTGGGAGGCGGCATCGCGCTGGGAACCGAAGGTGCGGTGCA
GGTCAAGGCCGCGCGCCACAGCTTGGGCGGTCCCGCCACCGACAGCATTGATCTGCCGGTCTTCGACCGT
GCCGGCGCCGACCAGCGCTTCGCGTTGCTCTACCCCGGCGCCGAGGGTGCGGAGCCGCAGCCTGCCGGCG
GACGGCGATACGAGATCACGCTGAAGGATGGGCGCGTCGTGGCCGGCACTGCCGACGCCGAGGGCAGGAC
CGACATGCTGACGAGCGAGGCCATGCAGGTGGCCCACATCCGTGTCTTCGACCGCTGA