SecReT6
Protein ID: 119897599
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1308
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1426635..1428473 [+]
Producthypothetical protein
NoteTssF
UniProt IDA1K520
KEGG IDazo:azo1308
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-210, Aligned region: 5..611
Protein Sequence: 612 a.a.     [Download]
>gi|119897599|ref|YP_932812.1| hypothetical protein azo1308 [Azoarcus sp. BH72]
MFDELLRYYETELGYLRELSGEFARRYPKIAGRLQLEGDQCEDPHVERLIEAFAFLGARIHRRLDDDLPE
ITASLLDALYPHFLQPVPSASIVQFELDPARPEVAGRYRIERGQMLLSPPVDDLACRFRTCYPVELYPLT
VASARVVFTAVSAHLAAQAPDATAVLTLSLETQGGVDLGALQLDRLRFFLDGEPALTYLIHQLLLQHEAQ
PWVEDQGGRLQRLPRGALRPVGFARDEGLLAYDDRSFLGYRLLTEYFTLPEKFLFVDVTGLPALSGQRFR
LHCPIRRYPGAERHTRLLESVEARHFRLGCTPVINLFPRAAEPVRVTHRRESYPIVVDARRPLGYEVIAI
ERVHYVERDDAGTRATEVPPLYGLNGAAEADAARFRWHARRDGSTRANDRGTEVSLHLVDARFSAVRPAT
EVLSLALLCSNRDLPERLPFGGGDAGPHTDFTLPGQAVVKRVRLLRKPTSSLRNPHRKGFQWRLVSHLSL
NYLSIVSQGKGALQDILALYNPLDRPAARRHIEGIREVNSAPAVARLAGPDFISFVRGTGVDLVLDEEAF
VGASAYLFASVLERFFALYCAPNSFVQLRYRCLNDEENVVQWPPRSGEAIVI
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|119896292|ref|NC_008702.1|:1426635-1428473 Azoarcus sp. BH72 chromosome, complete genome
ATGTTCGACGAACTGTTGCGCTACTACGAAACCGAACTCGGCTACCTGCGCGAACTCTCGGGCGAGTTCG
CGCGCCGTTACCCGAAGATCGCCGGCCGTCTTCAGCTGGAGGGAGACCAGTGCGAGGACCCGCATGTCGA
GCGTCTCATCGAAGCCTTCGCCTTTCTCGGTGCCCGCATCCATCGCCGCCTGGACGACGACCTGCCGGAA
ATCACCGCCAGCCTGCTCGACGCCCTGTATCCCCACTTTCTGCAACCTGTTCCTTCGGCCAGCATCGTGC
AGTTCGAACTCGACCCCGCGCGTCCGGAAGTGGCGGGGCGCTACCGGATAGAGCGCGGGCAGATGCTGCT
GTCGCCACCGGTGGACGACCTGGCCTGCCGGTTTCGCACCTGCTATCCGGTCGAGCTGTATCCGCTGACG
GTCGCGTCGGCCCGGGTGGTCTTCACCGCAGTCAGTGCCCACCTTGCCGCGCAGGCGCCGGATGCGACCG
CCGTGCTGACCTTGTCGCTGGAGACCCAGGGCGGCGTCGATCTCGGTGCGCTCCAGCTCGACCGGCTGCG
CTTCTTCCTCGATGGCGAGCCGGCGCTGACCTATCTGATCCACCAGTTGCTGCTGCAACACGAAGCGCAA
CCCTGGGTGGAGGACCAAGGCGGGCGGCTTCAGCGCCTGCCCCGCGGTGCGCTGCGGCCAGTCGGCTTTG
CCCGGGACGAGGGGCTGCTCGCCTATGACGACCGCTCCTTCCTCGGTTACCGCTTGCTGACCGAGTACTT
CACGCTGCCGGAGAAGTTCCTGTTCGTGGACGTCACCGGCCTGCCGGCGCTGTCGGGGCAGCGTTTTCGG
CTGCACTGCCCGATCAGGCGCTATCCAGGGGCAGAGCGCCATACCCGTCTGCTCGAAAGCGTCGAGGCGC
GGCATTTCCGCCTTGGCTGCACCCCGGTGATCAACCTGTTCCCGCGCGCAGCCGAACCGGTTCGCGTCAC
TCATCGGCGCGAGTCCTACCCGATCGTGGTGGACGCCCGCCGCCCGCTCGGTTATGAGGTGATCGCGATC
GAGCGTGTGCACTACGTCGAAAGGGACGACGCCGGCACGCGCGCAACGGAAGTCCCACCGCTCTATGGTT
TGAATGGGGCCGCAGAGGCGGATGCCGCGCGTTTTCGGTGGCATGCCCGGCGGGACGGTTCGACCCGGGC
CAACGACAGGGGAACCGAGGTATCGCTCCATCTGGTGGATGCCCGCTTCTCGGCCGTCCGCCCCGCGACG
GAGGTGCTGAGCCTGGCGCTGTTGTGCAGCAACCGCGACCTGCCGGAGCGACTGCCTTTTGGCGGCGGTG
ATGCCGGTCCGCACACCGATTTCACTCTGCCGGGACAGGCGGTGGTGAAGCGGGTGCGGCTGTTGCGCAA
GCCCACGTCCAGCCTGCGCAACCCGCACCGCAAGGGCTTCCAGTGGCGGCTGGTGTCGCACCTGTCGCTC
AACTACCTGTCCATCGTCAGCCAGGGCAAGGGGGCGCTGCAGGACATCCTCGCGCTCTACAACCCGCTCG
ACCGGCCGGCCGCGCGGCGCCACATCGAAGGTATCCGCGAGGTGAACAGCGCTCCCGCGGTTGCTCGTCT
TGCCGGCCCCGACTTCATCAGTTTCGTCCGTGGCACCGGGGTGGACCTCGTGCTGGACGAAGAGGCCTTT
GTCGGTGCCAGCGCCTACTTGTTCGCCAGCGTGCTCGAACGCTTCTTTGCCTTGTACTGCGCACCCAACA
GCTTCGTGCAATTGCGCTACCGGTGCCTGAACGATGAGGAGAACGTGGTCCAATGGCCACCCCGCAGCGG
CGAAGCGATCGTGATCTGA