SecReT6
Protein ID: 119897600
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1309
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1428437..1429453 [+]
Producthypothetical protein
NoteTssG
UniProt IDA1K521
KEGG IDazo:azo1309
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-89, Aligned region: 18..320
Protein Sequence: 338 a.a.     [Download]
>gi|119897600|ref|YP_932813.1| hypothetical protein azo1309 [Azoarcus sp. BH72]
MATPQRRSDRDLSAELAAEPHCFGFFQAVRLLELISEAAGHERPVRFRAALSLAFPPSELAAATVPAGAE
GERPMGGELSVAFMGLTGPSGVLPHVYTEMLLERNHLRHDGAAGAFLDLFNHRALALFHEGWRKYRHWLA
AERAGTDRFAEHLLDLCGLGPAALASIGGGETPARLAFLRYAGLLAQRPLSAHALETVIAGVLGVTVRIE
SFSGRWMVLPEAERSRLGTYACGLGSEACSGDRVWDAQGAVRLRVGPVRRQQFDTLLPGGAAARMLAGLI
RYAVGHALACTVVVVLDRRDIPQPRLGADAPLSLGGNLWFEARAREDDADDLRYALLD
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|119896292|ref|NC_008702.1|:1428437-1429453 Azoarcus sp. BH72 chromosome, complete genome
ATGGCCACCCCGCAGCGGCGAAGCGATCGTGATCTGAGTGCCGAGCTGGCCGCCGAACCGCACTGCTTCG
GCTTTTTCCAGGCGGTCCGCTTGCTGGAGCTGATCTCGGAGGCGGCCGGGCACGAGCGCCCGGTGCGCTT
TCGTGCGGCCCTGAGCCTTGCGTTTCCACCCAGTGAGCTTGCCGCGGCGACCGTGCCGGCGGGCGCCGAG
GGCGAGCGGCCAATGGGCGGAGAACTGAGCGTGGCCTTCATGGGCCTGACCGGCCCGAGCGGAGTCCTGC
CTCACGTCTACACCGAGATGCTGCTGGAGCGGAATCACCTGCGGCACGACGGTGCCGCAGGCGCGTTCCT
CGATCTCTTCAACCATCGGGCGCTGGCCCTGTTCCACGAGGGATGGCGAAAGTACCGTCACTGGCTGGCG
GCCGAACGCGCCGGCACGGACCGCTTCGCCGAGCATCTGCTCGATTTGTGCGGTTTGGGCCCGGCGGCAT
TGGCATCGATCGGCGGGGGTGAGACCCCTGCCCGGCTCGCCTTTCTACGCTACGCGGGCCTGCTCGCCCA
GCGCCCGCTGTCGGCGCACGCGCTGGAGACCGTAATCGCGGGCGTCCTCGGCGTAACAGTGCGGATCGAG
TCTTTCTCCGGGCGGTGGATGGTGTTGCCGGAAGCAGAACGCTCCCGTCTGGGTACTTACGCTTGCGGGC
TCGGCAGCGAGGCCTGTTCGGGCGACCGGGTGTGGGATGCGCAGGGTGCGGTCCGGCTGCGGGTGGGGCC
GGTGCGCCGTCAGCAGTTCGATACGCTGCTGCCCGGCGGTGCAGCGGCGCGGATGCTGGCGGGCCTCATC
CGCTATGCGGTGGGGCACGCGCTGGCCTGCACGGTGGTGGTGGTGCTTGACCGTCGCGACATACCTCAAC
CGCGCCTGGGCGCGGATGCGCCGTTGTCGCTCGGCGGCAATCTGTGGTTCGAGGCCAGGGCGCGGGAGGA
CGATGCGGACGATCTGCGCTACGCCTTGCTGGATTAG