SecReT6
Protein ID: 119897601
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1310
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1429450..1430565 [-]
Producthypothetical protein
NoteTssA
UniProt IDA1K522
KEGG IDazo:azo1310
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.10E-20, Aligned region: 57..118
Protein Sequence: 371 a.a.     [Download]
>gi|119897601|ref|YP_932814.1| hypothetical protein azo1310 [Azoarcus sp. BH72]
MDEAEFRAGLLAPISAANPAGEDLCYTPLFDDIRNARHADDDALGQGEWTHAVKAADWPRVVELCRTALC
ARSKDLQLAVWYVDALVRHQHWPALEFGLGFLSDLLDGFWAVVHPLPDGSDWGERTARLEWLGRQLADQV
AALPLIADEVRSYSLHDYRTAIERENRPDADSAAGAPAAAIDAERLRRAFRAADTAQLMQRRIQLAATLA
AASRLQDCCDQHFGMDGPSFAALQAEIGACDALLSRHLPPTITPPQSSQASTPARLQGEPDRPPSSRADD
LPSQPYSSDAPPLAPLPAGAPPDRDAAIRQLAEIGRFFRIHEPHSPVALLIERAVRWAGMPFEDWLQAVV
KDAATLDHLRELLDLPPGARN
 
Nucleotide Sequence: 1116 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c1430565-1429450 Azoarcus sp. BH72 chromosome, complete genome
ATGGACGAAGCCGAATTCCGCGCCGGCCTGCTGGCCCCGATTTCCGCCGCGAACCCCGCCGGCGAAGACC
TTTGCTACACCCCCCTGTTCGACGACATCCGCAACGCCCGCCACGCGGACGACGACGCCCTCGGCCAAGG
GGAATGGACGCACGCGGTCAAGGCGGCGGACTGGCCGCGCGTGGTCGAGTTATGCCGCACCGCGCTGTGC
GCCCGCAGCAAGGACCTGCAACTTGCCGTCTGGTATGTCGACGCGCTGGTCCGCCACCAGCACTGGCCGG
CGCTGGAATTCGGCCTCGGTTTCCTGTCCGACCTGCTGGACGGCTTCTGGGCAGTCGTGCATCCCCTGCC
CGACGGCAGCGACTGGGGGGAACGCACCGCGCGCCTCGAATGGCTGGGCCGCCAACTGGCGGACCAAGTG
GCCGCGCTTCCGCTCATTGCAGACGAAGTCCGCTCCTACAGCCTGCACGACTACCGCACGGCCATCGAGC
GCGAGAATCGCCCCGATGCCGACTCCGCCGCGGGCGCGCCCGCAGCGGCCATCGACGCAGAACGCCTGCG
GCGCGCCTTCCGCGCGGCAGACACCGCGCAACTGATGCAGCGGCGCATTCAGCTTGCGGCCACGCTCGCG
GCCGCAAGCCGCCTTCAGGACTGCTGCGACCAGCATTTCGGCATGGACGGACCGAGCTTCGCCGCACTCC
AGGCCGAGATCGGCGCATGCGACGCCCTCCTCTCCCGCCACTTGCCGCCCACCATCACCCCACCGCAGTC
GTCGCAGGCAAGCACCCCCGCGCGTCTGCAGGGCGAGCCGGATCGACCGCCCTCGTCGCGCGCCGACGAC
CTGCCGTCCCAGCCGTACTCCAGCGACGCGCCTCCCCTCGCCCCACTTCCAGCCGGCGCGCCGCCGGACC
GCGACGCGGCGATCAGGCAGTTGGCCGAGATCGGCCGCTTTTTTCGCATCCATGAGCCGCACAGCCCGGT
TGCACTGCTGATCGAACGCGCCGTCCGCTGGGCAGGGATGCCGTTCGAAGACTGGCTGCAGGCCGTGGTC
AAGGACGCTGCCACGCTGGATCACCTGCGCGAACTGCTCGACCTGCCGCCCGGCGCGCGAAACTAA