SecReT6
Protein ID: 119897602
SecReT6 ID160
T6SS typei4b
Gene symbol-
Locus tagazo1311
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]1430572..1430835 [-]
Producthypothetical protein
NotePAAR
UniProt IDA1K523
KEGG IDazo:azo1311
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 5.30E-26, Aligned region: 5..79
Protein Sequence: 87 a.a.     [Download]
>gi|119897602|ref|YP_932815.1| hypothetical protein azo1311 [Azoarcus sp. BH72]
MKRLIRLGDPTTHGGVVISASSSYEVLGRPVARVGDRVTCPMQGHGLAVIIEGDPDWLIDGRPVALEGHL
TSCGATLIATVASVGRE
 
Nucleotide Sequence: 264 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c1430835-1430572 Azoarcus sp. BH72 chromosome, complete genome
ATGAAACGCTTGATCCGGCTCGGGGACCCTACGACACACGGCGGCGTGGTGATCAGCGCCTCTTCCAGCT
ACGAAGTGCTCGGCCGCCCGGTCGCCCGCGTCGGCGATCGGGTCACCTGCCCGATGCAGGGCCACGGCCT
GGCTGTCATCATCGAAGGCGACCCCGACTGGCTGATCGACGGCCGGCCCGTCGCCCTCGAAGGCCACCTC
ACCAGTTGCGGCGCAACGCTGATCGCCACGGTGGCCAGCGTGGGCAGGGAGTAA