SecReT6
Protein ID: 119900164
SecReT6 ID161
T6SS typei3
Gene symbol-
Locus tagazo3875
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4247215..4249182 [+]
Productsigma-54-dependent transcriptional regulator
NoteSfa3
UniProt IDA1KCD5
KEGG IDazo:azo3875
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 2.40E-64, Aligned region: 333..495
Sigma54_activ_2 [PF14532], Evalue: 1.80E-21, Aligned region: 334..504
HTH_8 [PF02954], Evalue: 1.60E-09, Aligned region: 615..647
AAA_16 [PF13191], Evalue: 1.10E-05, Aligned region: 331..423
AAA [PF00004], Evalue: 1.30E-05, Aligned region: 356..475
AAA_5 [PF07728], Evalue: 4.60E-05, Aligned region: 355..474
HTH_23 [PF13384], Evalue: 5.10E-05, Aligned region: 46..72
HTH_23 [PF13384], Evalue: 5.10E-05, Aligned region: 619..646
HTH_28 [PF13518], Evalue: 0.00055, Aligned region: 29..45
HTH_28 [PF13518], Evalue: 0.00055, Aligned region: 47..86
HTH_28 [PF13518], Evalue: 0.00055, Aligned region: 619..642
Mg_chelatase [PF01078], Evalue: 0.00055, Aligned region: 355..453
DUF815 [PF05673], Evalue: 0.001, Aligned region: 323..381
PAS_4 [PF08448], Evalue: 0.0028, Aligned region: 131..174
PAS_4 [PF08448], Evalue: 0.0028, Aligned region: 227..282
T2SE [PF00437], Evalue: 0.0043, Aligned region: 337..376
Protein Sequence: 655 a.a.     [Download]
>gi|119900164|ref|YP_935377.1| sigma-54-dependent transcriptional regulator [Azoarcus sp. BH72]
MLAQSQREHIDHVLAVSQAGEPATDPIHRSWVRCVNDYGLDPSRPTRAHIVEQARLREHQDQIEDFLGVA
RTGMEQLYKRMAGIGYVLLLTDAHGIAVDFIGNDAWARELKHSGLYLGADWSETRAGTCAVGTCIVDKAP
ITCHHTDHFDASHITLTCNAAPLFDPTGGFLGVLDVSALTSPSPRDSQHLALHMVTMYAQMVEDASFLRY
FRDRWVLRLGSAWSMVDVSGEIMLAFDADGLIVGANSGARRALRPLDGVTDTLIGRPLGEVFREGMDAIW
RIARAGFSADRTALSTSGGEVYYGAVLQPRVAPLRPAPAVAATPAAPALERLAGNDPQMQRLIAQASRLV
NRPVNILVHGETGTGKEVLAKALHESSSRATKPFVAVNCAAIPESLIESELFGYTAGTFTGGRSKGMRGL
IQQADGGTLFLDEIGDMPLHLQTRLLRVLAEREVLPLGAEKPVPVNLTVVAASHRDLRKLIAEGSFREDL
YYRLCGAILYLPPLRERRDRDYLIDRLLAAEGAELGTSAALDPAARGLLLGYDWPGNVRQLRNVLRFALA
VCDGEHILPQDLPAELMASAPQAPSRTPAIATATAAVTAPAAVTTPGADPVRGELEAALRRHHWNITAAA
AELGVCRATIYRQMKRHGIVPPHLL
 
Nucleotide Sequence: 1968 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4247215-4249182 Azoarcus sp. BH72 chromosome, complete genome
ATGCTGGCGCAATCCCAGCGCGAACACATCGACCATGTGCTCGCCGTATCACAGGCGGGCGAACCCGCCA
CCGACCCGATCCACCGCTCGTGGGTCCGCTGTGTGAACGACTACGGCCTCGACCCGAGCCGGCCGACCCG
CGCGCATATCGTCGAACAGGCCCGCCTGCGCGAGCACCAGGACCAGATCGAGGACTTCCTCGGCGTCGCC
CGCACCGGCATGGAGCAGCTCTACAAGCGCATGGCCGGCATCGGCTACGTGCTGCTGCTGACCGACGCCC
ACGGCATCGCGGTGGACTTCATCGGCAACGACGCCTGGGCGCGCGAGCTGAAGCACTCCGGCCTCTATCT
CGGCGCCGACTGGAGCGAAACCCGTGCCGGCACCTGTGCGGTGGGCACCTGCATCGTCGACAAGGCGCCG
ATCACCTGTCACCACACCGATCACTTCGACGCGTCGCACATCACGCTGACCTGTAATGCCGCGCCGCTGT
TCGACCCCACCGGCGGCTTCCTCGGCGTGCTCGACGTCTCGGCGCTGACCTCGCCGTCGCCGCGCGACAG
CCAGCATCTGGCGCTGCACATGGTGACGATGTATGCGCAGATGGTGGAGGACGCCAGCTTCCTGCGCTAT
TTCCGCGACCGCTGGGTGCTGCGGCTGGGCTCGGCGTGGTCGATGGTCGATGTGTCGGGCGAGATCATGC
TCGCCTTCGATGCCGATGGCCTCATCGTCGGCGCCAACAGCGGCGCCCGGCGCGCACTGCGCCCGCTCGA
CGGCGTCACCGACACCCTGATCGGGCGCCCGCTCGGCGAGGTTTTCCGCGAGGGCATGGACGCGATCTGG
CGCATCGCCCGCGCCGGTTTTTCCGCCGACCGCACCGCGCTGTCCACCAGCGGCGGCGAGGTCTATTACG
GTGCCGTGCTGCAACCGCGCGTGGCCCCGCTGCGCCCGGCGCCCGCCGTCGCCGCCACCCCGGCGGCGCC
CGCGCTGGAGCGCCTCGCCGGCAACGACCCGCAGATGCAGCGCCTGATCGCACAGGCGTCGCGGCTGGTG
AACCGGCCGGTGAACATCCTGGTGCACGGCGAAACCGGCACCGGCAAGGAAGTGCTGGCGAAAGCGCTGC
ACGAATCCAGCAGCCGCGCCACCAAGCCCTTCGTCGCGGTCAATTGCGCGGCGATCCCGGAATCGCTGAT
CGAGAGCGAACTGTTCGGCTACACCGCCGGCACCTTCACCGGCGGGCGCAGCAAGGGCATGCGCGGGCTG
ATCCAGCAGGCCGACGGCGGCACGCTGTTCCTCGACGAGATCGGCGACATGCCGCTGCACCTGCAGACCC
GGCTGCTGCGCGTGCTGGCCGAGCGCGAGGTGCTGCCGCTGGGCGCCGAGAAGCCGGTGCCGGTGAATCT
CACCGTGGTCGCCGCCTCGCACCGCGACCTGCGCAAGCTGATCGCCGAAGGCAGCTTCCGCGAGGATCTC
TACTACCGCCTGTGCGGCGCCATCCTGTACCTGCCGCCGCTGCGCGAACGGCGCGACCGCGACTACCTGA
TCGACCGCCTGCTCGCGGCCGAAGGCGCGGAACTGGGCACCAGCGCCGCGCTGGACCCGGCCGCGCGCGG
CCTGCTGCTGGGCTACGACTGGCCCGGCAACGTGCGCCAGCTGCGCAATGTGCTGCGCTTCGCGCTGGCG
GTGTGCGATGGCGAGCACATCCTGCCGCAGGACCTGCCCGCCGAACTGATGGCGAGCGCACCGCAAGCGC
CGTCACGCACGCCCGCCATCGCGACCGCGACCGCGGCCGTCACTGCGCCCGCGGCGGTCACCACGCCGGG
CGCCGACCCGGTGCGCGGCGAACTGGAGGCCGCGCTGCGCCGTCATCACTGGAACATCACCGCCGCCGCG
GCCGAACTCGGCGTCTGCCGCGCGACCATCTACCGGCAGATGAAACGCCACGGCATCGTGCCGCCCCATC
TGCTGTAG