SecReT6
Protein ID: 119900165
SecReT6 ID161
T6SS typei3
Gene symbol-
Locus tagazo3876
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4249321..4251393 [+]
Producthypothetical protein
NoteTssI
UniProt IDA1KCD6
KEGG IDazo:azo3876
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-86, Aligned region: 27..326
Phage_base_V [PF04717], Evalue: 4.40E-27, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 5.20E-18, Aligned region: 511..533
Gp5_C [PF06715], Evalue: 5.20E-18, Aligned region: 535..557
Gp5_C [PF06715], Evalue: 5.20E-18, Aligned region: 558..581
Gp5_C [PF06715], Evalue: 5.20E-18, Aligned region: 583..605
Gp5_C [PF06715], Evalue: 5.20E-18, Aligned region: 607..621
Gp5_C [PF06715], Evalue: 5.20E-18, Aligned region: 637..659
Gp5_C [PF06715], Evalue: 5.20E-18, Aligned region: 654..663
DUF2345 [PF10106], Evalue: 0.0054, Aligned region: 315..343
DUF2345 [PF10106], Evalue: 0.0054, Aligned region: 629..679
Protein Sequence: 690 a.a.     [Download]
>gi|119900165|ref|YP_935378.1| hypothetical protein azo3876 [Azoarcus sp. BH72]
MADQSQFELITPLGSGVLVFQALAADEALSQVSEFEIDCLSDKTDINLDDILGKQLSLRVMLPTGGKRYF
SGYVTRFAHTGTQGRYQTYRASVRPWLWFLGRTADCRIFQSRTVPDIVKQVFSEHGVADFRNALSGSYRT
REYCVQYRETDLAFVSRLLEEEGIYYFFEHDENKNTLVLADAYAAHSSTAGYEEIEFVENRQGGGDELGF
VSQWQFERQVMPGKVMLRDYDFTKPSVGLEASAVVPREHDEGKHEVFDYPGEFDQVADGRHYAKVRVDEL
HAQFELSRARSSARGLAVGHLFKLAGHARRDQNREYLITAAQTRVRAEGRESEAGAGSQFECHFSALNSR
QDYRPPRLTPRPQVKGPQTAVVVGPSGNEIYTDEYGRVKVQFHWDRYGTKDEHSSCWIRVSHPWAGKNWG
FIAIPRIGQEVIVEFLEGDPDQPIITGRVYNAEQMPPYALPDNMTQTGIKTRSTLGGGTDNFNEIRFEDK
KGEEQLFIHAEKNQDIEVENDETHWVGHDRTKNIDHNETVTVGNDRTESVGNNETISIGNNRTESVGANE
TISVGGNRAEDVGQNETVSIGKDRSESIGNNDAHDVAKNQTIAIGENQTLEVGKARSTTVGDDDKLQVGK
KLVIEAGDEITIKTGSASITMKKDGTIQIKGKDITIKGDGQIGIKAASDVVIKGAKISEN
 
Nucleotide Sequence: 2073 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4249321-4251393 Azoarcus sp. BH72 chromosome, complete genome
GTGGCAGATCAATCGCAATTCGAACTCATCACCCCGCTGGGCAGCGGCGTGCTCGTATTCCAGGCGCTCG
CCGCCGACGAGGCGCTGTCGCAGGTCAGCGAATTCGAGATCGACTGCCTCTCCGACAAGACCGACATCAA
CCTCGACGACATCCTCGGCAAGCAGCTCAGCCTGCGGGTGATGCTGCCCACCGGCGGCAAGCGCTACTTC
AGCGGCTACGTCACCCGCTTCGCCCACACCGGCACCCAGGGCCGCTACCAGACCTACCGCGCGAGCGTGC
GGCCGTGGCTGTGGTTCCTCGGCCGCACCGCCGACTGCCGCATCTTCCAGTCGCGCACGGTGCCCGACAT
CGTCAAGCAGGTCTTCTCCGAACACGGCGTCGCCGACTTCCGCAACGCGCTCAGCGGCAGCTACCGCACG
CGCGAATACTGCGTGCAGTACCGCGAGACCGACCTCGCCTTCGTCAGCCGGCTGCTGGAAGAAGAGGGCA
TCTATTACTTCTTCGAGCACGACGAGAACAAGAACACGCTGGTGCTGGCCGACGCCTACGCCGCGCACAG
CAGCACCGCCGGCTACGAGGAGATCGAGTTCGTCGAGAACCGCCAGGGCGGCGGCGACGAGCTGGGCTTC
GTCAGCCAGTGGCAGTTCGAGCGCCAGGTGATGCCGGGCAAGGTCATGCTGCGCGACTACGACTTCACCA
AGCCCTCGGTCGGGCTGGAAGCCTCGGCGGTGGTGCCGCGCGAACACGACGAGGGCAAGCACGAGGTGTT
CGACTACCCCGGCGAGTTCGACCAGGTGGCCGACGGCCGCCACTACGCCAAGGTGCGCGTCGATGAGCTG
CACGCGCAGTTCGAACTGTCCCGCGCGCGCAGCAGCGCCCGCGGCCTGGCGGTGGGCCACCTGTTCAAGC
TCGCCGGTCACGCCCGCCGCGACCAGAACCGCGAGTACCTGATCACCGCGGCGCAGACCCGCGTGCGTGC
CGAAGGGCGGGAATCCGAAGCGGGTGCGGGCAGCCAGTTCGAGTGCCACTTCAGCGCCCTCAACAGCCGC
CAGGATTACCGCCCGCCGCGGCTGACCCCGCGCCCGCAGGTGAAGGGGCCGCAGACCGCGGTAGTGGTCG
GCCCGTCCGGCAACGAGATCTACACCGACGAATACGGCCGCGTGAAGGTGCAGTTCCACTGGGACCGCTA
CGGCACCAAGGACGAGCACAGCTCGTGCTGGATCCGCGTCTCCCATCCCTGGGCGGGCAAGAACTGGGGC
TTCATCGCCATCCCCCGCATCGGCCAGGAGGTGATCGTCGAATTCCTCGAGGGCGATCCCGACCAGCCGA
TCATCACCGGCCGGGTCTACAACGCCGAGCAGATGCCGCCATACGCGCTGCCCGACAACATGACCCAGAC
CGGCATCAAGACGCGCTCCACGCTCGGCGGCGGCACCGACAACTTCAACGAGATCCGCTTCGAGGACAAG
AAGGGCGAGGAGCAGCTCTTCATCCACGCCGAGAAGAACCAGGACATCGAGGTCGAGAACGACGAGACCC
ACTGGGTCGGCCACGACCGCACCAAGAACATCGACCACAACGAGACGGTCACCGTGGGCAACGACCGCAC
CGAGTCGGTCGGCAACAACGAAACCATCAGCATCGGCAACAACCGCACCGAATCGGTGGGCGCCAACGAA
ACCATCTCGGTGGGCGGCAACCGCGCCGAGGACGTCGGCCAGAACGAAACCGTCAGCATCGGCAAGGACC
GCAGCGAGAGCATCGGCAACAACGACGCCCACGACGTCGCCAAGAACCAGACCATCGCGATCGGCGAAAA
CCAGACGCTGGAGGTGGGCAAGGCGCGCTCCACCACGGTCGGCGATGACGACAAGCTGCAGGTCGGCAAG
AAACTGGTGATCGAGGCCGGCGACGAGATCACCATCAAGACCGGCAGCGCCAGCATCACCATGAAGAAGG
ACGGCACGATCCAGATCAAGGGCAAGGACATCACCATCAAGGGCGACGGCCAGATCGGCATCAAGGCCGC
TTCCGACGTGGTGATCAAGGGCGCCAAGATCTCCGAGAACTGA