SecReT6
Protein ID: 119900170
SecReT6 ID161
T6SS typei3
Gene symbol-
Locus tagazo3881
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4255159..4255536 [+]
Producthypothetical protein
NotePAAR
UniProt IDA1KCE1
KEGG IDazo:azo3881
PDB IDNA
Domain hit(s) vs Pfam DUF4150 [PF13665], Evalue: 6.20E-38, Aligned region: 18..124
PAAR_motif [PF05488], Evalue: 0.00035, Aligned region: 28..120
Protein Sequence: 125 a.a.     [Download]
>gi|119900170|ref|YP_935383.1| hypothetical protein azo3881 [Azoarcus sp. BH72]
MPCTVHNIQGFAHKTSNGISMVFPDVCNTPSPGGPIPIPYPNIGKSSDTTAGTTTVKADGSMVMVKGAKY
MMSAGDEPGTAGGVISGTFKQECEFLMYSFDVMLDGKNVCRMGDPLWHNKKNICG
 
Nucleotide Sequence: 378 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4255159-4255536 Azoarcus sp. BH72 chromosome, complete genome
ATGCCATGCACCGTCCATAACATCCAGGGGTTCGCCCACAAGACCAGCAACGGCATCAGCATGGTCTTTC
CCGACGTCTGCAACACGCCCTCGCCCGGCGGGCCGATCCCCATCCCCTACCCGAACATCGGCAAGTCCTC
CGACACCACCGCCGGCACCACCACGGTGAAAGCCGACGGCAGCATGGTGATGGTGAAGGGCGCCAAGTAC
ATGATGAGCGCGGGCGACGAACCCGGTACCGCAGGCGGCGTGATCTCCGGCACCTTCAAGCAGGAATGCG
AGTTCCTGATGTACTCCTTCGACGTGATGCTGGACGGCAAGAACGTCTGCCGCATGGGCGACCCCCTGTG
GCACAACAAGAAGAACATTTGCGGATAG