SecReT6
Protein ID: 119900173
SecReT6 ID161
T6SS typei3
Gene symbol-
Locus tagazo3884
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4257210..4259045 [+]
Productregulatory protein
NoteFha
UniProt IDA1KCE4
KEGG IDazo:azo3884
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.90E-12, Aligned region: 28..93
Protein Sequence: 611 a.a.     [Download]
>gi|119900173|ref|YP_935386.1| regulatory protein [Azoarcus sp. BH72]
MLRISVIQVNGFPPATPLAGEFDERGGTIGRDDSNALTLPDPGRHISRMQAQVQYDGSRYVLTDHGGNPT
HLNGRPLGKGASATLRDGDEIGIADYTLRVEIVRTVSGFGNETLPNIEQRGDPLGLDLDLALPPDLPAGL
GAPAAAAPPPRAAALDDDPFAVFAAATPTPPAPPAAAPPAASVSDDPFAAFAPARPAPPPAPASSRAGDP
LGIGALAQPAEASSLDALFGLDGASTGGDPFAGSPLGNPAHAPAPFDGGGEDPLALLGGMAATPSSAPVR
NDSPLLNDAFAPPRLIDDSPPRPLAPAPASAAAPAPQRSPAAPQGGVVSWASTPAAPAAPAAPAVPAAGD
DGREAPTRIVPAFPPPEAPRANVGIERAPLTPAPAPAPSPVPPASAPAAAAQPAAASAGSSADADALLAA
FARGIGLPRLAPAGGLTPELMEHIGRMLREAVQGTVELLVARAATKREVRADVTMIVSKNNNPLKFSPDV
DFALMQLLLPQGSGFMKPDEAMQDAYDDLRAHQLGFMAGMRAALASILGRFTPAELEARLTTKSFLDNVL
PANRKAKLWDLYEQRYGDISREAEDDFHSLFGREFLKAYEAQIDQLQRERG
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4257210-4259045 Azoarcus sp. BH72 chromosome, complete genome
GTGCTACGCATCAGTGTCATCCAGGTCAACGGCTTTCCGCCCGCCACCCCGCTTGCCGGCGAATTCGACG
AGCGCGGCGGCACCATCGGTCGCGACGACAGCAACGCGCTGACCCTGCCCGACCCCGGCCGCCACATCTC
GCGCATGCAGGCCCAGGTCCAGTACGACGGCAGCCGCTATGTGCTGACCGACCACGGCGGCAACCCCACC
CATCTCAACGGCCGCCCGCTGGGCAAGGGCGCCAGTGCCACGCTGCGCGACGGCGACGAGATCGGCATCG
CCGACTACACGCTGCGGGTCGAGATCGTGCGCACCGTATCCGGCTTCGGTAACGAAACGCTGCCCAACAT
CGAACAGCGCGGCGACCCGCTCGGGCTGGATCTCGATCTCGCGCTGCCGCCCGATCTTCCGGCGGGCCTC
GGCGCCCCGGCCGCAGCCGCGCCGCCGCCGCGCGCCGCCGCGCTCGACGACGATCCGTTCGCGGTGTTCG
CCGCCGCCACGCCGACGCCGCCCGCGCCGCCTGCTGCCGCTCCGCCCGCGGCGTCGGTGTCCGACGACCC
GTTCGCGGCATTCGCGCCCGCGCGGCCGGCCCCGCCCCCCGCGCCCGCGTCCAGCCGCGCGGGCGATCCG
CTCGGCATCGGTGCGCTGGCGCAGCCCGCCGAAGCGAGTTCGCTCGACGCGCTGTTCGGCCTCGACGGCG
CCAGCACCGGCGGCGACCCCTTCGCCGGCTCGCCGCTCGGCAACCCGGCCCATGCGCCCGCCCCGTTCGA
CGGGGGCGGCGAAGACCCGCTGGCGCTGCTCGGCGGCATGGCGGCAACGCCCAGCAGCGCCCCGGTGCGC
AACGATTCGCCGCTGCTCAACGACGCCTTCGCCCCGCCGCGCCTGATCGACGACAGCCCACCGCGGCCGC
TTGCCCCCGCCCCAGCGTCCGCCGCCGCACCGGCACCGCAGCGCAGCCCCGCTGCGCCGCAAGGCGGCGT
GGTGTCGTGGGCCAGCACGCCCGCCGCCCCCGCCGCACCGGCAGCGCCGGCAGTGCCGGCCGCCGGGGAC
GACGGACGCGAGGCGCCGACCCGCATCGTGCCCGCATTCCCCCCGCCGGAGGCCCCGCGCGCCAACGTCG
GCATCGAACGCGCGCCGCTGACGCCCGCCCCGGCGCCGGCGCCCTCCCCCGTGCCGCCGGCGTCTGCACC
AGCCGCCGCGGCGCAACCCGCGGCCGCCAGCGCCGGCTCCAGTGCCGACGCCGACGCGCTGCTGGCCGCC
TTTGCCCGCGGCATCGGCCTGCCGCGGCTGGCCCCGGCGGGCGGGCTGACCCCCGAACTGATGGAGCACA
TCGGCCGCATGCTGCGCGAGGCGGTGCAGGGCACGGTGGAACTGCTGGTCGCGCGCGCGGCCACCAAGCG
CGAGGTGCGCGCGGACGTGACCATGATCGTCAGCAAGAACAACAACCCGCTGAAGTTCTCGCCCGACGTC
GATTTCGCGCTGATGCAGCTGCTGCTGCCGCAGGGCAGCGGCTTCATGAAGCCGGACGAGGCGATGCAGG
ACGCCTACGACGATCTGCGCGCCCATCAGCTCGGCTTCATGGCCGGCATGCGTGCGGCGCTGGCGAGCAT
CCTCGGCCGCTTCACCCCGGCCGAGCTGGAAGCCCGCCTGACCACCAAGAGCTTCCTCGACAACGTGCTG
CCGGCCAACCGCAAGGCCAAGCTGTGGGACCTCTACGAGCAACGCTATGGCGACATCTCGCGCGAGGCCG
AGGACGACTTCCATTCGCTGTTCGGGCGCGAGTTCCTGAAGGCCTACGAGGCCCAGATCGACCAGTTGCA
GCGCGAACGCGGCTGA