SecReT6
Protein ID: 119900180
SecReT6 ID161
T6SS typei3
Gene symbolompA2
Locus tagazo3891
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4268313..4269617 [-]
Producthypothetical protein
NoteTssL
UniProt IDA1KCF1
KEGG IDazo:azo3891
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-69, Aligned region: 55..258
OmpA [PF00691], Evalue: 3.60E-14, Aligned region: 325..422
Protein Sequence: 434 a.a.     [Download]
>gi|119900180|ref|YP_935393.1| hypothetical protein azo3891 [Azoarcus sp. BH72]
MNQDDPFGQPPGDRTLVIPNPGARAARPAAAAAPAQGFSFGRVELSALDWSAGLNPLVAAANPLLNLVPQ
LRQAHHPDPAGLRETLARAVQAFETKAREVGVLNEHVVGARYALCTFLDETAANTPWGEKIWAQKSLLVQ
FHNEAWGGEKFFQLLGKVAEQPGTHRNLLELFYIILALGFEGRYRVLQNGRAQLDAVRERLAQMILKERG
EPVRELSPQWQTTATSARPLRDSVPIWAVAAIAALLLVLIYLAASYALNRHSDPAFAQILGLKVPPPAPL
AQAAAVPAKVPDRLQGFLAPEIREGLVTVRDLPDRSVVQIQGDGLFEPASATLAPRVLPLMARIGEAVAR
VKGSVLVRGHSDDRPIRSARFPSNWHLSQARADSVAAVLAPQLGGARIETEGRAESEPVASNDTPEGRAR
NRRVEIIVFPAAGD
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c4269617-4268313 Azoarcus sp. BH72 chromosome, complete genome
ATGAACCAAGACGATCCTTTCGGCCAGCCACCCGGCGACCGTACGCTGGTGATTCCCAACCCGGGAGCGC
GCGCCGCGCGCCCGGCGGCGGCCGCGGCGCCGGCGCAGGGCTTCAGCTTCGGGCGGGTTGAGCTGTCCGC
GCTCGACTGGAGCGCCGGCCTCAATCCGCTGGTCGCCGCCGCCAATCCCTTGCTCAACCTGGTGCCGCAG
CTGCGTCAGGCCCATCACCCCGATCCCGCCGGGCTGCGCGAAACGCTCGCGCGCGCGGTGCAGGCCTTCG
AAACCAAGGCGCGCGAGGTCGGCGTGCTCAACGAGCATGTCGTCGGCGCCCGCTACGCGCTGTGCACCTT
CCTCGACGAGACCGCCGCCAACACGCCGTGGGGCGAGAAGATCTGGGCGCAGAAGAGCCTGCTGGTGCAG
TTCCACAACGAAGCCTGGGGCGGCGAGAAGTTCTTCCAGCTGCTGGGCAAGGTCGCCGAGCAGCCCGGCA
CCCACCGCAACCTGCTCGAACTCTTCTACATCATCCTGGCGCTCGGCTTCGAGGGCCGCTATCGCGTGCT
GCAGAACGGCCGCGCCCAGCTCGACGCGGTGCGCGAACGGCTGGCGCAGATGATCCTCAAGGAGCGCGGC
GAGCCGGTGCGCGAACTGTCACCTCAGTGGCAGACCACCGCGACCAGCGCGCGCCCGCTGCGCGACTCGG
TGCCGATCTGGGCGGTCGCGGCGATTGCCGCGCTGCTGCTGGTGCTGATCTATCTGGCCGCGTCCTACGC
GCTCAACCGCCACTCCGACCCCGCTTTCGCGCAGATCCTCGGCCTCAAGGTGCCGCCGCCGGCGCCGCTG
GCACAGGCCGCCGCGGTGCCGGCGAAGGTGCCCGACCGGTTGCAGGGCTTCCTCGCCCCCGAAATCCGCG
AAGGGCTGGTGACCGTGCGCGACCTGCCGGACCGCAGCGTGGTGCAGATCCAGGGCGACGGCCTGTTCGA
ACCGGCCAGCGCCACGCTGGCGCCGCGCGTGCTGCCGCTGATGGCGCGCATCGGCGAGGCGGTGGCGCGG
GTCAAGGGTTCGGTGCTGGTGCGCGGCCATTCCGACGACCGTCCGATCCGCTCCGCGCGCTTCCCGTCCA
ACTGGCATCTGTCGCAGGCCCGCGCCGATTCGGTGGCGGCGGTGCTGGCGCCGCAGCTCGGCGGCGCGCG
CATCGAGACCGAGGGCCGCGCCGAGAGCGAGCCGGTTGCCTCCAACGACACCCCGGAAGGGCGCGCGCGC
AACCGCCGCGTCGAGATCATCGTGTTCCCGGCCGCGGGCGACTGA