SecReT6
Protein ID: 119900181
SecReT6 ID161
T6SS typei3
Gene symbolimpJ
Locus tagazo3892
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4269682..4271016 [-]
Producthypothetical protein
NoteTssK
UniProt IDA1KCF2
KEGG IDazo:azo3892
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-152, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|119900181|ref|YP_935394.1| hypothetical protein azo3892 [Azoarcus sp. BH72]
MSWFSKVVWSEGLFLRPQHFQQQDRYSEWRGDSLRRQLQPNGWGFSTLELDDAALAIGKVSIRAASGILP
DGTPFDFPAAHEGPVAFDFPADAKDALVVLTLPLQRPLMPEYRIEGDDDALARYDVADAALPDAAGGGGS
AEIVQVGRPRLALGLAQDYSDAFVRLGVLRVTERRPDGSLLVDRGYIPPVLGCGCAPQLASMLREVLGLL
GQRGEALAGRMSQGGTGGVAEIADFLFLLAVNRHLPVMAHLEQLRPLHPERLYSQLLALMGELATLTAPE
RRPPALPAYRHDALQDSFDPLMREIRRALSSILEQNAVQIPLQDLKQGRYVGVIADRGLLRQAGFVLAVN
AQIPAEAVRSRFPTQAKLGPVEKLRDLVNLQLPGIALRPLPVAPRQIPFHAGYTYFELDNSGDLWKQLDS
SGGLGMYVTGDFPGLDVALWAIRA
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c4271016-4269682 Azoarcus sp. BH72 chromosome, complete genome
ATGTCCTGGTTCAGCAAGGTCGTATGGTCCGAAGGGCTGTTCCTGCGCCCGCAGCATTTCCAGCAGCAGG
ACCGCTATTCGGAATGGCGCGGCGACAGCCTGCGCCGGCAGCTTCAGCCCAACGGCTGGGGTTTTTCCAC
GCTGGAACTCGATGACGCGGCGCTCGCCATCGGCAAGGTCTCGATCCGCGCTGCCAGCGGCATCCTGCCG
GACGGCACGCCGTTCGACTTTCCCGCTGCCCACGAGGGGCCGGTTGCGTTCGACTTTCCCGCCGACGCCA
AGGACGCGCTGGTGGTGCTGACGCTGCCACTGCAGCGCCCGCTGATGCCGGAATACCGCATCGAAGGCGA
CGACGACGCACTCGCCCGCTACGACGTCGCCGACGCCGCCTTGCCCGACGCCGCGGGCGGGGGCGGAAGC
GCGGAGATCGTCCAGGTCGGGCGGCCGCGGCTCGCGCTCGGGCTGGCGCAGGATTACTCCGACGCCTTCG
TCCGCCTCGGCGTGCTGCGCGTGACCGAGCGGCGCCCCGACGGCAGCCTGCTGGTCGACCGCGGCTACAT
TCCGCCGGTGCTCGGCTGCGGCTGCGCGCCCCAGCTCGCGTCGATGCTGCGCGAGGTGCTCGGGCTGCTC
GGCCAGCGCGGCGAAGCGCTCGCCGGCCGCATGAGCCAGGGCGGCACCGGCGGCGTCGCGGAAATCGCCG
ACTTCCTGTTCCTGCTCGCGGTCAATCGCCACCTGCCGGTGATGGCCCACCTCGAACAACTGCGGCCGCT
CCATCCGGAGCGGCTGTACAGCCAGCTGCTCGCGCTGATGGGCGAACTCGCCACGCTGACCGCGCCGGAA
CGGCGCCCACCCGCACTGCCGGCCTACCGCCACGACGCGCTGCAGGATTCGTTCGACCCGCTGATGCGAG
AGATCCGCCGCGCGCTGTCGTCCATCCTGGAACAGAACGCGGTGCAGATCCCGCTGCAGGATCTCAAGCA
GGGCCGCTACGTCGGCGTCATTGCCGACCGCGGCCTGCTGCGCCAGGCCGGCTTCGTGCTGGCGGTCAAC
GCGCAGATTCCGGCCGAAGCGGTGCGCTCGCGCTTTCCCACCCAGGCCAAGCTCGGCCCGGTGGAAAAGC
TGCGCGACCTGGTCAACCTGCAGCTGCCCGGCATCGCGCTGCGGCCGCTGCCGGTGGCGCCGCGCCAGAT
TCCCTTCCACGCCGGATACACCTATTTCGAACTCGACAACAGCGGCGACCTGTGGAAGCAGCTCGACAGC
TCGGGCGGCCTCGGCATGTACGTCACCGGGGATTTCCCCGGCCTCGACGTCGCGCTGTGGGCGATCCGTG
CATGA