SecReT6
Protein ID: 119900182
SecReT6 ID161
T6SS typei3
Gene symbol-
Locus tagazo3893
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4271065..4271583 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA1KCF3
KEGG IDazo:azo3893
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.80E-41, Aligned region: 18..156
Protein Sequence: 172 a.a.     [Download]
>gi|119900182|ref|YP_935395.1| hypothetical protein azo3893 [Azoarcus sp. BH72]
MNVRASALRVVLPAVAAAVLAACSKPVVAPPKPEPTVVTPTLAAAPRINIDTRGRPTPVVLRVYLLKNAS
AFEGADFFSLFDREQQVLGDAVLAREEIVLKPGETRTLDARDAEGARVVGVLAAFREVDRAVWRATVPVV
PNRGNLVTIRVEDDRISLAATLAPLPPPKKAD
 
Nucleotide Sequence: 519 bp     [Download]
>gi|119896292|ref|NC_008702.1|:c4271583-4271065 Azoarcus sp. BH72 chromosome, complete genome
TTGAATGTTCGCGCCAGCGCGCTGCGTGTCGTGCTGCCGGCGGTCGCCGCGGCGGTGCTCGCGGCCTGCT
CCAAGCCGGTCGTCGCACCGCCCAAGCCCGAGCCGACGGTGGTGACGCCGACGCTCGCGGCCGCTCCCCG
CATCAATATAGATACGCGCGGCCGCCCCACCCCGGTGGTGTTGCGGGTGTATCTGCTGAAGAACGCCTCG
GCGTTCGAGGGCGCGGATTTCTTCTCGCTGTTCGATCGCGAGCAGCAGGTGCTCGGCGACGCGGTGCTGG
CGCGCGAGGAGATCGTCCTCAAGCCCGGCGAGACGCGCACGCTGGATGCCCGTGATGCCGAGGGCGCCCG
CGTGGTCGGCGTGCTCGCCGCGTTCCGCGAGGTGGACCGCGCGGTGTGGCGCGCCACCGTGCCCGTCGTT
CCCAATCGCGGCAACCTGGTGACGATCCGCGTCGAGGACGACCGCATCAGCCTCGCCGCCACCCTGGCGC
CGTTGCCGCCGCCCAAGAAAGCCGACTAA