SecReT6
Protein ID: 119900183
SecReT6 ID161
T6SS typei3
Gene symbolsciA
Locus tagazo3894
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4271852..4272913 [+]
Productputative cytoplasmic protein
NoteTssA
UniProt IDA1KCF4
KEGG IDazo:azo3894
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.10E-22, Aligned region: 61..121
ImpA-rel_N [PF06812], Evalue: 3.10E-22, Aligned region: 187..213
Protein Sequence: 353 a.a.     [Download]
>gi|119900183|ref|YP_935396.1| putative cytoplasmic protein [Azoarcus sp. BH72]
MSLELDLDTLLAPLGDDQPCGPNLEYDADFLQMEEAARGQAGQEFASDSGSKVSIDGQEADWPAVRRLAE
GLLERTRDVRVAVYYTRALLRTEGYPGIHAGLRLIVGLLEQHWAGVHPELDADDNDDPTMRVNALAPLVA
NDAVIGDLRASTLLRSRQSGVLTVRNIEVTQGKLSARDGEQVLAESQVAGMLAEAVAADPTLADAITDSV
ALARQLSGFLQDQVGAGASIDFKPLQNVLYAVQQALGGVALPAADGPGEAAAGEEGAPAGVPAAGTPAAP
GEIRSRADVVATIDRLVTYLERSEPTNPAQWLLRRAQRVMNMNFLEAIVELAPDGLEQAERMVGGQLNPE
QDD
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4271852-4272913 Azoarcus sp. BH72 chromosome, complete genome
ATGTCGCTGGAACTCGATCTCGACACACTGCTGGCACCGCTGGGCGATGACCAACCCTGCGGCCCCAACC
TCGAATACGACGCCGACTTCCTCCAGATGGAAGAGGCCGCGCGCGGGCAAGCCGGCCAGGAGTTCGCGAG
CGACAGCGGCAGCAAGGTCAGCATCGATGGCCAGGAAGCGGACTGGCCCGCGGTGCGCCGGCTCGCCGAG
GGCCTCCTCGAGCGCACCCGGGACGTCCGCGTCGCGGTCTATTACACCCGCGCGCTGCTGCGCACCGAAG
GCTATCCCGGCATCCACGCGGGACTCCGCCTGATCGTCGGCCTGCTCGAACAGCACTGGGCCGGCGTCCA
CCCCGAACTCGACGCCGACGACAACGACGACCCGACGATGCGGGTGAATGCGCTGGCGCCGCTGGTTGCC
AACGACGCGGTGATCGGCGACCTGCGCGCCAGCACGCTGTTGCGCTCGCGCCAGTCCGGCGTGCTGACGG
TGCGCAACATCGAGGTCACCCAGGGCAAGCTCAGCGCGCGCGACGGCGAACAGGTGCTGGCCGAGTCCCA
GGTGGCCGGCATGCTGGCCGAAGCGGTCGCGGCCGATCCCACCCTGGCCGACGCGATCACCGACAGCGTC
GCGCTCGCCCGCCAGCTCTCCGGCTTCCTGCAGGATCAGGTGGGCGCCGGCGCCAGCATCGATTTCAAGC
CGCTGCAGAACGTCCTTTACGCCGTGCAGCAGGCGCTCGGCGGCGTTGCGCTGCCCGCTGCCGACGGCCC
GGGCGAGGCCGCGGCCGGTGAGGAAGGCGCCCCGGCCGGCGTGCCGGCCGCCGGCACGCCCGCGGCCCCG
GGCGAAATCCGCTCGCGCGCCGACGTCGTCGCCACCATCGACCGCCTGGTGACCTACCTCGAACGCAGCG
AACCGACCAACCCCGCGCAGTGGCTGCTGCGGCGTGCCCAGCGGGTGATGAACATGAACTTCCTCGAAGC
CATCGTCGAACTTGCCCCCGATGGTCTCGAACAAGCCGAGCGCATGGTCGGCGGCCAGCTCAACCCCGAG
CAGGACGACTAG