SecReT6
Protein ID: 119900188
SecReT6 ID161
T6SS typei3
Gene symbolsciE
Locus tagazo3899
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4276353..4277174 [+]
Producthypothetical protein
NoteTagJ
UniProt IDA1KCF9
KEGG IDazo:azo3899
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.50E-44, Aligned region: 145..267
TPR_11 [PF13414], Evalue: 6.80E-08, Aligned region: 11..68
TPR_11 [PF13414], Evalue: 6.80E-08, Aligned region: 118..142
TPR_16 [PF13432], Evalue: 1.90E-07, Aligned region: 9..65
TPR_16 [PF13432], Evalue: 1.90E-07, Aligned region: 107..141
TPR_19 [PF14559], Evalue: 7.00E-06, Aligned region: 15..71
TPR_19 [PF14559], Evalue: 7.00E-06, Aligned region: 120..141
TPR_14 [PF13428], Evalue: 6.30E-05, Aligned region: 9..47
TPR_14 [PF13428], Evalue: 6.30E-05, Aligned region: 42..72
TPR_14 [PF13428], Evalue: 6.30E-05, Aligned region: 105..141
TPR_15 [PF13429], Evalue: 0.0048, Aligned region: 9..62
TPR_15 [PF13429], Evalue: 0.0048, Aligned region: 110..140
TPR_2 [PF07719], Evalue: 0.0082, Aligned region: 11..36
TPR_2 [PF07719], Evalue: 0.0082, Aligned region: 47..68
TPR_2 [PF07719], Evalue: 0.0082, Aligned region: 120..139
Protein Sequence: 273 a.a.     [Download]
>gi|119900188|ref|YP_935401.1| hypothetical protein azo3899 [Azoarcus sp. BH72]
MSAPAKTLADAEAALRAGDPDAALAQLQAAVRSQPADAKLRVFLFQLLAVLGQWERALNQLNVATELDAS
TLAMAQMYRETLRCEVLRAEVFAGKRVPLLFGEPEQWLALLLESLLTAGRGDHAAALRLREQAFELAPAS
PGRIDGSPFAWLADADGRLGPVCEAVINGRYYWIPYARLASIDIEAPSDLRDFVWAPAHFVFTNGGETVG
VIPTRYSGSESAADGALKLGRRTEWLEHDGDYRGLGQRLLTTDGAEYALLDIRRIEFDATVDG
 
Nucleotide Sequence: 822 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4276353-4277174 Azoarcus sp. BH72 chromosome, complete genome
ATGTCCGCCCCCGCCAAAACCCTAGCCGACGCCGAAGCCGCGCTGCGCGCCGGCGACCCCGACGCCGCCC
TCGCCCAGCTGCAGGCCGCGGTACGGTCCCAGCCCGCCGATGCCAAGCTGCGTGTGTTCCTGTTCCAGTT
GCTGGCCGTGCTCGGCCAGTGGGAACGCGCCCTCAACCAGCTCAACGTCGCCACCGAACTCGACGCGTCC
ACGCTCGCGATGGCGCAGATGTACCGCGAGACGCTGCGCTGCGAAGTGCTGCGCGCCGAGGTCTTCGCCG
GCAAGCGCGTTCCCTTGTTGTTCGGCGAACCCGAACAGTGGCTCGCGCTGCTGCTCGAATCGCTGCTGAC
CGCGGGCCGCGGCGACCATGCCGCCGCGCTGCGCCTGCGCGAACAGGCGTTCGAACTGGCACCCGCGAGC
CCCGGCCGCATCGACGGCTCGCCCTTCGCGTGGCTCGCCGACGCCGACGGCCGCCTCGGCCCGGTGTGCG
AGGCGGTAATCAACGGCCGCTACTACTGGATTCCGTACGCGCGGCTCGCCAGCATCGACATCGAAGCGCC
GAGCGACCTGCGCGACTTCGTCTGGGCGCCCGCCCACTTCGTGTTCACCAACGGCGGCGAAACCGTGGGC
GTGATCCCCACCCGCTACTCGGGTTCGGAAAGCGCCGCCGACGGCGCGCTCAAGCTCGGCCGCCGTACCG
AATGGCTGGAGCACGACGGCGACTACCGCGGCCTCGGTCAGCGCCTGCTGACCACCGACGGCGCCGAATA
CGCCCTGCTCGACATCCGCCGCATCGAGTTCGACGCCACTGTCGATGGCTGA