SecReT6
Protein ID: 119900189
SecReT6 ID161
T6SS typei3
Gene symbolsciD
Locus tagazo3900
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4277167..4277676 [+]
Producthypothetical protein
NoteTssE
UniProt IDA1KCG0
KEGG IDazo:azo3900
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.30E-22, Aligned region: 37..146
Protein Sequence: 169 a.a.     [Download]
>gi|119900189|ref|YP_935402.1| hypothetical protein azo3900 [Azoarcus sp. BH72]
MADLLPLDRLQPALLDRLRDDAPDQRHEAKEARVLGRSQLREAVLRDLTWLLNAMRPPEREGVGVWPEVE
NSVLNYGMPCFSGETASSLDITDLERAIRDSLLRFEPRIIPGTLEVSTEQHENILDWHNVISVRISAQIW
AQPVPLELLLRTQLDLESGLVEVRDINGY
 
Nucleotide Sequence: 510 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4277167-4277676 Azoarcus sp. BH72 chromosome, complete genome
ATGGCTGACCTGCTGCCGCTCGACCGCCTGCAGCCGGCGCTGCTCGACCGCCTGCGCGACGACGCGCCGG
ACCAGCGCCACGAGGCCAAGGAAGCGCGCGTGCTCGGCCGCAGCCAGCTGCGCGAGGCGGTGCTGCGCGA
CCTCACCTGGCTGCTCAACGCGATGCGCCCGCCGGAGCGGGAGGGCGTCGGGGTGTGGCCGGAGGTCGAG
AACTCGGTGCTGAACTACGGCATGCCGTGCTTTTCCGGGGAAACCGCGTCCTCGCTCGACATCACCGACC
TCGAACGCGCAATCCGCGACTCGCTGCTGCGTTTCGAGCCGCGCATCATCCCCGGCACGCTCGAGGTCAG
CACCGAGCAGCACGAGAACATCCTCGACTGGCACAACGTGATCAGCGTGCGCATCTCGGCGCAGATCTGG
GCGCAGCCGGTGCCGCTCGAACTGCTGCTGCGCACCCAGCTCGACCTCGAAAGCGGCCTGGTCGAGGTGC
GCGACATCAACGGCTACTGA