SecReT6
Protein ID: 119900192
SecReT6 ID161
T6SS typei3
Gene symbolclpB2
Locus tagazo3903
StrainAzoarcus sp. BH72
Repliconchromosome [GenBank: NC_008702] [Browse all T6SS(s) in this replicon]
Location [Strand]4280714..4283434 [+]
Productputative ATP-dependent Clp protease, ATP-binding subunit ClpB
NoteTssH
UniProt IDA1KCG3
KEGG IDazo:azo3903
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.60E-38, Aligned region: 231..253
AAA_2 [PF07724], Evalue: 7.60E-38, Aligned region: 638..804
AAA [PF00004], Evalue: 8.50E-18, Aligned region: 232..343
AAA [PF00004], Evalue: 8.50E-18, Aligned region: 644..728
ClpB_D2-small [PF10431], Evalue: 2.10E-14, Aligned region: 479..518
ClpB_D2-small [PF10431], Evalue: 2.10E-14, Aligned region: 811..886
AAA_5 [PF07728], Evalue: 3.10E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 3.10E-13, Aligned region: 643..772
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 38..61
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 209..255
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 633..688
AAA_16 [PF13191], Evalue: 1.70E-10, Aligned region: 708..727
Sigma54_activat [PF00158], Evalue: 2.70E-07, Aligned region: 210..256
Sigma54_activat [PF00158], Evalue: 2.70E-07, Aligned region: 642..760
Zeta_toxin [PF06414], Evalue: 9.60E-06, Aligned region: 231..254
Zeta_toxin [PF06414], Evalue: 9.60E-06, Aligned region: 638..683
Arch_ATPase [PF01637], Evalue: 2.70E-05, Aligned region: 126..157
Arch_ATPase [PF01637], Evalue: 2.70E-05, Aligned region: 210..252
Arch_ATPase [PF01637], Evalue: 2.70E-05, Aligned region: 283..386
Arch_ATPase [PF01637], Evalue: 2.70E-05, Aligned region: 643..676
Arch_ATPase [PF01637], Evalue: 2.70E-05, Aligned region: 710..725
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 232..261
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 644..672
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 231..261
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 368..398
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 641..672
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 705..730
AAA_19 [PF13245], Evalue: 7.00E-05, Aligned region: 229..255
AAA_19 [PF13245], Evalue: 7.00E-05, Aligned region: 510..531
AAA_19 [PF13245], Evalue: 7.00E-05, Aligned region: 641..666
AAA_14 [PF13173], Evalue: 8.70E-05, Aligned region: 232..300
AAA_14 [PF13173], Evalue: 8.70E-05, Aligned region: 338..398
AAA_14 [PF13173], Evalue: 8.70E-05, Aligned region: 642..730
AAA_17 [PF13207], Evalue: 0.00026, Aligned region: 232..256
AAA_17 [PF13207], Evalue: 0.00026, Aligned region: 643..679
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 232..255
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 645..677
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 224..254
IstB_IS21 [PF01695], Evalue: 0.00038, Aligned region: 643..672
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 35..58
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 227..304
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 358..400
AAA_25 [PF13481], Evalue: 0.00053, Aligned region: 625..668
SRP54 [PF00448], Evalue: 0.0019, Aligned region: 232..270
SRP54 [PF00448], Evalue: 0.0019, Aligned region: 642..679
Clp_N [PF02861], Evalue: 0.0029, Aligned region: 29..69
Clp_N [PF02861], Evalue: 0.0029, Aligned region: 106..132
AAA_29 [PF13555], Evalue: 0.0062, Aligned region: 224..247
AAA_29 [PF13555], Evalue: 0.0062, Aligned region: 641..668
MobB [PF03205], Evalue: 0.0083, Aligned region: 44..63
MobB [PF03205], Evalue: 0.0083, Aligned region: 233..264
MobB [PF03205], Evalue: 0.0083, Aligned region: 642..674
Protein Sequence: 906 a.a.     [Download]
>gi|119900192|ref|YP_935405.1| putative ATP-dependent Clp protease, ATP-binding subunit ClpB [Azoarcus sp. BH72]
MSEISRVASFGKLNSLAYKAMEGATVFCKLRGNPYVELEHWLQQLLQNEDTDLHRIVRHFDVDAARLAAD
MTTALDRLPRGSTSISGLSENLDTLVERGWVYASLMFGDRQIRSGYLLVGMLKTPSLRNALMAISRQFER
VRPDVLTDEFTKIVAGSAEENLTARDGSGGAPGEDSGAIAPAQMGKQEALKKFTVDLTEQARSGKMDPIV
GRDEEIRQVVDILMRRRQNNPILVGEAGVGKTAVVEGFAQRIARGDVPPALKDVSLLALDVGLLQAGASM
KGEFEQRLRSVIDEVQASPKPIILFVDETHTLVGAGGAAGTGDAANLLKPALARGTLRTVGATTWAEYKK
YIEKDPALTRRFQNVQVDEPDEKKAVLMMRGVASTMEKHHQVQILDEALEAAVKLSHRYIPARQLPDKSV
SLLDTACARVAVSLHATPAEVDDSRKRIDALNTELEIIGRESNIGIEVGERRAHAEALLAEEQQRLAELE
ARWAAEKTLVDELLALRAKLRSGSRPVEGTGSALEAAAEAAAPEAAAESAPEPEREALFARLREVQAELA
TLQGEDPLILPTVDYQAVASVVADWTGIPVGRMARNEIENVLRLPQLLGQRVIGQDHAMEMIAKRIQTSR
AGLDNPNKPIGVFMLAGTSGVGKTETALALAEALYGGEQNVVTINMSEFQEAHTVSTLKGAPPGYVGYGE
GGVLTEAVRRKPYSVVLLDEVEKAHPDVHEMFFQVFDKGFMEDGEGRFIDFKNTLILLTTNAGTDLIASM
CKDPDLLPDPEGLAKALRDPLLKIFPPALLGRLVTIPYYPLTDAMLGAIVRLQLGRIKKRVEARYKIPFE
YGDDVVELVVSRCTESESGGRMIDAILTNTMLPDISREFLNRTMEGKPIVRVAMGVANADFTYNFD
 
Nucleotide Sequence: 2721 bp     [Download]
>gi|119896292|ref|NC_008702.1|:4280714-4283434 Azoarcus sp. BH72 chromosome, complete genome
ATGAGCGAAATCAGTCGGGTAGCCTCGTTCGGCAAACTCAACAGCCTCGCCTACAAGGCGATGGAAGGCG
CCACCGTCTTCTGCAAGCTGCGCGGCAATCCCTATGTGGAGCTGGAACACTGGCTGCAGCAGCTGCTGCA
GAACGAGGACACCGACCTGCACCGCATCGTGCGCCACTTCGACGTGGACGCGGCGCGCCTGGCCGCCGAC
ATGACCACCGCGCTCGACCGCCTGCCGCGCGGCTCGACCTCGATCTCGGGCCTCTCCGAAAACCTCGACA
CGCTCGTCGAACGCGGCTGGGTGTATGCCTCTCTGATGTTCGGCGACCGCCAGATCCGCTCCGGCTACCT
GCTGGTCGGCATGCTCAAGACGCCCTCGCTGCGCAACGCGCTGATGGCGATCTCGCGCCAGTTCGAGCGC
GTGCGCCCCGATGTGCTGACCGACGAATTCACCAAGATCGTCGCCGGCTCGGCGGAAGAAAACCTCACCG
CGCGCGATGGCTCGGGCGGCGCGCCGGGCGAGGACAGCGGCGCGATTGCGCCCGCGCAGATGGGCAAGCA
GGAGGCGCTGAAGAAATTCACCGTCGACCTCACCGAGCAGGCCCGCTCCGGCAAGATGGACCCGATCGTC
GGCCGCGACGAAGAAATCCGCCAGGTGGTCGACATCCTGATGCGCCGCCGCCAGAACAACCCCATCCTGG
TCGGCGAGGCCGGCGTCGGCAAGACCGCGGTGGTCGAAGGCTTCGCCCAGCGCATCGCGCGCGGCGACGT
GCCGCCGGCGCTCAAGGACGTCTCGCTGCTGGCGCTGGATGTCGGCCTGCTGCAGGCCGGCGCCAGCATG
AAGGGCGAATTCGAGCAGCGACTGCGCTCGGTCATCGACGAAGTCCAGGCCAGCCCCAAGCCCATCATCC
TGTTCGTCGATGAGACCCACACCCTGGTCGGCGCCGGCGGCGCGGCCGGCACCGGCGATGCGGCCAACCT
GCTCAAGCCGGCGCTCGCGCGCGGCACGCTGCGCACCGTCGGCGCCACCACCTGGGCCGAGTACAAGAAG
TACATCGAGAAGGACCCGGCGCTGACCCGGCGCTTCCAGAACGTGCAGGTCGACGAGCCGGACGAGAAGA
AGGCGGTGCTCATGATGCGCGGCGTTGCCAGCACCATGGAGAAGCACCACCAGGTGCAGATCCTCGACGA
GGCGCTGGAGGCCGCGGTCAAGCTGTCGCACCGCTACATCCCGGCGCGCCAGCTGCCGGACAAGTCCGTC
TCGCTGCTCGACACCGCCTGCGCCCGCGTCGCGGTGAGCCTGCACGCCACCCCGGCCGAGGTGGACGACA
GCCGCAAGCGCATCGACGCGCTGAACACCGAGCTGGAAATCATCGGCCGCGAGAGCAACATCGGCATCGA
GGTCGGCGAGCGCCGTGCCCATGCCGAGGCCCTGCTGGCCGAAGAACAGCAGCGGCTGGCCGAACTCGAG
GCGCGCTGGGCGGCCGAGAAGACGCTGGTCGATGAACTCCTCGCGCTGCGCGCCAAGCTGCGCAGCGGCA
GCCGCCCGGTGGAAGGCACCGGCAGCGCGCTGGAAGCCGCGGCCGAAGCGGCTGCGCCGGAGGCCGCCGC
CGAGAGCGCGCCCGAACCCGAGCGCGAGGCGCTGTTCGCGCGCCTGCGCGAAGTGCAGGCCGAACTCGCC
ACGCTGCAGGGCGAAGACCCGCTGATCCTGCCGACAGTGGACTACCAGGCGGTGGCCTCGGTGGTCGCCG
ACTGGACCGGCATCCCGGTCGGCCGCATGGCGCGCAACGAAATCGAGAACGTGCTGCGCCTGCCGCAGCT
GCTCGGCCAGCGCGTCATCGGCCAGGACCACGCGATGGAGATGATCGCCAAGCGCATCCAGACTTCGCGC
GCCGGGCTCGACAACCCCAACAAGCCGATCGGCGTGTTCATGCTCGCCGGCACCTCGGGCGTCGGCAAGA
CCGAAACCGCGCTGGCACTGGCCGAAGCGCTGTACGGCGGCGAGCAGAACGTCGTCACGATCAACATGAG
CGAATTCCAGGAAGCGCACACCGTGTCCACGCTCAAGGGCGCGCCTCCGGGCTACGTCGGCTACGGCGAA
GGCGGCGTGCTGACCGAGGCGGTGCGGCGCAAGCCCTACAGCGTGGTGCTGCTCGACGAGGTCGAGAAGG
CCCACCCCGATGTGCACGAGATGTTCTTCCAGGTCTTCGACAAGGGCTTCATGGAAGACGGCGAAGGCCG
CTTCATCGACTTCAAGAACACCCTGATCCTGCTCACCACCAATGCCGGCACCGACCTCATCGCCAGCATG
TGCAAGGACCCCGACCTGCTGCCCGACCCGGAAGGCCTCGCCAAGGCGCTGCGCGACCCGCTGCTGAAGA
TCTTCCCGCCGGCGCTGCTCGGCCGCCTCGTCACCATTCCCTACTACCCGCTGACCGACGCCATGCTGGG
CGCCATCGTCCGGCTGCAGCTCGGGCGCATCAAGAAGCGCGTGGAAGCGCGCTACAAGATCCCGTTCGAG
TATGGCGACGACGTGGTCGAGCTGGTGGTCAGCCGCTGCACCGAGAGCGAATCCGGCGGCCGCATGATCG
ACGCCATCCTGACCAACACCATGCTGCCCGACATCAGCCGCGAGTTCCTGAACCGGACGATGGAAGGCAA
GCCGATCGTGCGCGTGGCGATGGGAGTCGCGAATGCCGACTTCACCTACAACTTCGATTGA