SecReT6
Protein ID: 120610152
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1465
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1617808..1618290 [-]
Producthypothetical protein
NoteTssD
UniProt IDA1TM68
KEGG IDaav:Aave_1465
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.70E-37, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|120610152|ref|YP_969830.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSVDMFMKVEGASGESQDANHKSWTDIRSFTWGATQPNSMATGSGAGAGKVTFHDLNVVAKIDKAYPAVL
KHCSSGKHLGQVEISMCKAGGTQIEFSKITLTDVLVTSVTVSGTDGSDAVLVNYAFQAAKIKTQYWEQTN
QGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|120608714|ref|NC_008752.1|:c1618290-1617808 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGTCCGTCGATATGTTCATGAAGGTTGAAGGTGCCAGCGGCGAATCACAAGACGCCAACCACAAGAGCT
GGACCGACATCCGCTCCTTCACCTGGGGCGCGACGCAACCCAACTCGATGGCCACGGGCAGCGGCGCCGG
CGCCGGCAAGGTCACTTTCCACGACCTGAACGTCGTGGCCAAGATCGACAAGGCCTACCCGGCCGTGCTC
AAGCACTGCTCCTCCGGCAAGCACCTGGGTCAGGTGGAGATCTCGATGTGCAAGGCCGGCGGCACGCAGA
TCGAATTCAGCAAGATCACGCTCACCGACGTGCTGGTCACGAGCGTCACCGTCAGCGGCACCGACGGCAG
CGATGCCGTCCTGGTGAATTACGCATTCCAGGCCGCCAAAATCAAGACCCAATACTGGGAACAGACGAAC
CAGGGCGGCAAGGGTGCAGAAAGCTCGGCCGGCTGGAACATCAAGGAAAACAAAGAAGCCTGA