SecReT6
Protein ID: 120610155
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1468
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1621473..1623806 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDA1TM71
KEGG IDaav:Aave_1468
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.30E-10, Aligned region: 30..97
Protein Sequence: 777 a.a.     [Download]
>gi|120610155|ref|YP_969833.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MDKVELRVVRHADEAVDRLWTAVFGVAGGTIGRGGQNKLVLSDSDAGVARVHAMVRIESEAAFIANLCER
RSIFVAGAEVRSGEEVRLAVGDEVRIGPYVLHSVVPGSPFVPVAAVPAPVPAPAPEPVSAPAPVANPSSP
ASAAGVPVPVSVPVAIPVANVPQGEGLTVVPSPPVAMPAAGTGEGLAAAAASAEEDDNPFAMLGRVEGPA
IAASAPSRAPAPAALPTASTAPIPAFGPVPADAPVPPSRSASMPAPDGVHGFAASPASAIPVPSDQGRQD
NAWSPAVPQDRPAAAPAPRALVIPEDFDLFAVDPRKGEEKKDAWGSGLQAKSLSEIANMRHDELLQSLPA
SGAKFAHDMDNPAHAGLPKALDPRDELDPLRLFTGGSDAASALVPERSAMVLGSGSDLSQSFSLPRGVQA
PVGPGLPGAAEVPGSSPPVVQGAGTNPGMASAAPPAPPLEGLQRVEGLDLGAFGSGSASADPLGWPPVES
GPAPAAVDVLPQATLSGLAAGDAKAVPIEEVALAHVPAAAGTPAPVPAPAPAPAPAPTASHGPAGEEGTP
KSPLAPVLPELEAASPAELQSLIAAFLEGAGVLQKKVEPQKLSPEFMRSFGEAFRVAVQGTIDLLAARSE
IKREFRAGVTVISSGANNPLKFLPTPEGVVMQMIGQNFPGFMKPIPAMQEAYDDLRVHQVALMAGLRAAY
AEALERFDPAALEQRTDVTGGVFGKLSATSRKAALWDEYKRNFAEIRRGAEDDLAAFSGQAFLEAYENAE
AAAKART
 
Nucleotide Sequence: 2334 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1621473-1623806 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGGACAAAGTCGAACTCAGGGTCGTCCGCCATGCGGACGAAGCGGTGGACCGCTTATGGACGGCGGTAT
TCGGCGTGGCGGGCGGAACGATCGGCCGCGGAGGGCAGAACAAGCTCGTGCTGTCCGACAGCGATGCGGG
TGTCGCCCGCGTGCATGCGATGGTGCGCATCGAATCCGAGGCCGCCTTCATCGCCAATCTCTGCGAGCGC
CGGTCGATTTTCGTGGCGGGTGCCGAAGTGCGCTCGGGCGAAGAGGTGCGCCTGGCAGTGGGGGACGAGG
TCCGCATCGGGCCCTACGTCCTGCATTCCGTCGTGCCGGGCTCGCCCTTCGTTCCCGTGGCGGCTGTTCC
TGCTCCAGTTCCGGCTCCCGCCCCCGAACCCGTATCTGCGCCCGCTCCGGTAGCGAATCCGTCGTCCCCG
GCCTCTGCCGCCGGCGTGCCGGTTCCCGTTTCCGTTCCCGTAGCCATTCCGGTGGCGAACGTGCCGCAGG
GCGAGGGGCTGACTGTCGTGCCGTCGCCGCCTGTGGCGATGCCTGCGGCCGGAACGGGAGAAGGCCTGGC
GGCGGCCGCGGCCTCTGCGGAGGAAGACGACAACCCCTTCGCGATGCTTGGTCGCGTGGAAGGGCCGGCC
ATCGCCGCCTCGGCCCCGTCCCGGGCCCCGGCGCCGGCCGCCTTGCCCACGGCCTCGACTGCGCCCATAC
CCGCGTTCGGCCCCGTGCCCGCCGACGCACCTGTGCCGCCATCCCGGTCCGCGTCCATGCCTGCCCCGGA
CGGGGTCCATGGTTTCGCCGCGTCGCCCGCATCGGCGATTCCGGTGCCTTCCGACCAGGGTCGGCAGGAC
AATGCCTGGTCCCCGGCGGTGCCGCAGGACAGGCCCGCCGCGGCACCGGCCCCCCGGGCCCTCGTCATTC
CGGAGGACTTCGATCTTTTCGCGGTGGACCCCCGCAAGGGCGAGGAGAAAAAGGATGCCTGGGGGAGCGG
TTTGCAGGCTAAGAGCCTGAGCGAGATCGCCAACATGCGGCACGACGAACTGCTGCAGTCGCTGCCGGCC
AGCGGCGCGAAATTCGCGCACGACATGGACAACCCGGCCCATGCCGGGCTGCCCAAGGCGCTGGACCCGC
GCGACGAACTCGACCCGCTGCGGCTCTTCACGGGCGGCTCGGATGCGGCCTCGGCACTGGTGCCCGAACG
TTCGGCGATGGTGCTCGGTTCGGGGTCCGACCTGTCTCAGTCGTTCAGCCTTCCGAGGGGCGTGCAGGCG
CCGGTGGGGCCGGGGCTCCCCGGCGCGGCAGAGGTGCCGGGAAGTTCCCCGCCGGTCGTCCAGGGCGCCG
GCACGAACCCGGGCATGGCGTCCGCCGCGCCACCGGCCCCTCCGCTGGAGGGCCTGCAGCGTGTGGAAGG
ACTCGACCTTGGTGCCTTCGGCTCCGGTTCCGCTTCGGCCGATCCACTGGGCTGGCCGCCCGTGGAGAGC
GGGCCCGCCCCCGCTGCTGTCGACGTGCTGCCGCAAGCCACGCTTTCCGGGCTGGCTGCCGGCGATGCGA
AGGCCGTGCCCATCGAGGAGGTGGCGCTGGCGCATGTTCCTGCCGCGGCCGGCACGCCTGCTCCAGTCCC
GGCGCCGGCCCCCGCGCCCGCTCCTGCGCCCACCGCCTCCCACGGCCCGGCTGGGGAAGAGGGCACCCCG
AAGTCGCCCCTGGCTCCGGTGCTGCCGGAACTGGAAGCCGCTTCGCCAGCGGAGTTGCAGTCGCTGATCG
CCGCCTTCCTGGAAGGCGCGGGGGTGCTGCAGAAGAAGGTCGAGCCGCAGAAGCTCAGTCCCGAGTTCAT
GCGATCGTTCGGGGAAGCCTTCCGCGTGGCCGTGCAGGGCACCATCGACCTGCTGGCCGCCCGCTCCGAG
ATCAAGCGCGAATTCCGCGCAGGCGTGACGGTGATTTCCTCCGGCGCGAACAATCCGCTGAAGTTCCTGC
CGACGCCCGAGGGCGTGGTCATGCAGATGATCGGGCAGAATTTCCCGGGGTTCATGAAGCCGATCCCCGC
CATGCAGGAGGCCTACGACGACCTGCGGGTCCACCAGGTGGCCCTGATGGCCGGCCTGCGCGCGGCCTAC
GCCGAGGCGCTGGAGCGTTTCGATCCCGCGGCCCTGGAGCAGCGCACCGACGTGACCGGTGGGGTGTTCG
GCAAGCTGTCGGCCACGAGCCGCAAGGCAGCGCTGTGGGACGAGTACAAGCGCAATTTCGCCGAGATCCG
GCGCGGCGCCGAGGACGACCTGGCGGCCTTCTCCGGCCAGGCCTTCCTGGAGGCCTATGAAAACGCCGAG
GCGGCGGCGAAGGCCAGGACGTGA