SecReT6
Protein ID: 120610157
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1470
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1624635..1625198 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDA1TM73
KEGG IDaav:Aave_1470
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-34, Aligned region: 23..177
Protein Sequence: 187 a.a.     [Download]
>gi|120610157|ref|YP_969835.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MHREAMARKGFIRAGLAAAAAAWLLGGCGMISNLNRPQEAPTAVPPAVFEIVADPGVNPDIHGTPKPILL
RIYELRAAAAFDRASYLDLQDKDEAQLGADFVRREEILLQPGERRTIERKGSADVRTFAVFAGYRDLERS
TWRATAGAPNSVEMRRRWWGLGETERLKPVQYRITVGKDAVKIQTAP
 
Nucleotide Sequence: 564 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1624635-1625198 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCATCGGGAAGCGATGGCACGGAAGGGATTCATCAGGGCGGGGCTCGCGGCCGCGGCGGCGGCATGGC
TGCTGGGCGGCTGCGGCATGATCAGCAACCTGAACCGCCCGCAGGAGGCCCCCACGGCCGTGCCGCCGGC
CGTGTTCGAAATCGTCGCGGACCCTGGCGTCAACCCCGATATCCACGGCACGCCCAAGCCCATCCTGCTG
AGGATTTACGAACTGCGCGCGGCGGCGGCTTTCGACCGGGCAAGCTACCTGGACCTGCAGGACAAGGACG
AAGCCCAGCTGGGGGCCGATTTCGTGCGGCGCGAGGAGATCCTGCTGCAGCCGGGCGAGCGGCGCACCAT
CGAGCGCAAGGGCAGTGCGGATGTCCGCACCTTCGCCGTGTTCGCAGGCTACCGCGACCTGGAGCGCAGC
ACCTGGCGCGCGACCGCGGGCGCTCCCAACTCCGTGGAGATGCGCCGCCGCTGGTGGGGCCTGGGCGAAA
CCGAGCGGCTCAAGCCCGTGCAGTACCGCATCACAGTGGGCAAGGATGCGGTGAAGATCCAGACCGCTCC
TTAA