SecReT6
Protein ID: 120610158
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1471
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1625240..1626574 [+]
Producthypothetical protein
NoteTssK
UniProt IDA1TM74
KEGG IDaav:Aave_1471
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.00E-160, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|120610158|ref|YP_969836.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MVWQRKVVWAEGMFLRPQHFQQQDRYTDFLVQARTLPAQFFFWGFSKLALDTELLGLGKLGLLSGEGVLP
DGTPFSFPHHDQAPAALAIGKDVKDTVIHLALPMRRRAGAEVTLGAPGGASVRYAAEVAEVPDVNDMGAQ
AAEVQIGNIQLSLRAAQDVTDGWVSLPVAQVVERRADGSLLLDPSFIPTVVNNSEMSGLATYCRELFGLL
RQRGAALEERLSQPGRGGVGEVGDFLMLQFLNRWEPAVEHWVRVRAIHPERLFDDLLKMAGELATFTREQ
RRPAAMPTYDHDDLRSCFLPLMLELRRGLSSVLEQNAIQIELQERQYGVHVALIPSTELLTSCDFVLAVH
AQTAVEFLRAHFPTQIKMGPVERIRDLVNLHLPGVPLRSLPVAPREIPYHAGYSYFELDTGHDLWRQLQN
SGGLALHVSGGFPELQLEMWAIRR
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1625240-1626574 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGGTTTGGCAGCGCAAGGTCGTCTGGGCCGAAGGGATGTTCCTTCGCCCGCAGCATTTCCAGCAACAGG
ACCGCTACACCGATTTCCTCGTGCAGGCCCGCACGTTGCCGGCCCAGTTCTTCTTCTGGGGCTTCTCCAA
GCTGGCGCTCGATACGGAGCTGCTGGGGCTGGGCAAGCTGGGCCTGCTGTCCGGAGAGGGCGTGCTGCCG
GACGGCACGCCGTTCAGCTTTCCGCACCATGACCAGGCGCCCGCCGCGCTGGCGATCGGCAAGGACGTCA
AGGACACGGTCATCCACCTGGCCCTGCCGATGCGGCGCAGGGCCGGCGCGGAGGTGACGCTGGGCGCGCC
CGGCGGCGCTTCGGTGCGCTATGCGGCCGAGGTGGCGGAAGTCCCGGACGTCAACGACATGGGCGCCCAG
GCGGCCGAGGTGCAGATCGGGAACATCCAGCTGTCGCTGCGCGCCGCGCAGGACGTCACCGACGGATGGG
TGAGCCTGCCCGTGGCCCAGGTGGTGGAGCGCAGGGCGGACGGATCGCTGCTGCTGGATCCGTCCTTCAT
TCCCACGGTGGTCAACAATTCCGAGATGTCGGGGCTGGCCACCTACTGCCGCGAGCTCTTCGGCCTGCTG
CGGCAGCGGGGCGCGGCGCTGGAAGAGCGACTGAGCCAGCCCGGACGGGGCGGCGTGGGGGAGGTCGGCG
ATTTCCTGATGCTGCAGTTCCTGAACCGCTGGGAGCCGGCGGTGGAGCACTGGGTGCGCGTGCGGGCCAT
CCACCCCGAGCGGCTGTTCGACGATCTGCTGAAGATGGCCGGCGAACTGGCGACGTTCACGCGCGAGCAG
CGCCGGCCCGCGGCCATGCCGACCTACGACCACGACGATCTGCGCAGCTGCTTCCTGCCCCTGATGCTCG
AATTGCGCCGGGGGCTCTCCTCGGTGCTGGAACAGAACGCGATCCAGATCGAGTTGCAGGAACGCCAGTA
CGGCGTCCACGTGGCGCTCATCCCGAGCACGGAACTGCTCACCAGCTGCGACTTCGTGCTGGCGGTGCAT
GCGCAGACCGCCGTGGAGTTCCTGCGGGCGCATTTCCCCACGCAGATCAAGATGGGGCCCGTGGAACGCA
TCCGCGACCTCGTGAACCTGCACCTGCCCGGCGTGCCGTTGCGTTCGCTGCCGGTCGCGCCGCGCGAGAT
CCCTTACCACGCGGGCTATTCCTACTTCGAGCTGGACACGGGACACGACCTGTGGCGCCAGTTGCAGAAC
TCGGGCGGCCTGGCGCTGCACGTCTCGGGAGGCTTCCCTGAGCTGCAGCTCGAAATGTGGGCCATACGGC
GCTGA