SecReT6
Protein ID: 120610159
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1472
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1626583..1627941 [+]
Producthypothetical protein
NoteTssL
UniProt IDA1TM75
KEGG IDaav:Aave_1472
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.90E-70, Aligned region: 50..255
OmpA [PF00691], Evalue: 9.40E-18, Aligned region: 318..416
Protein Sequence: 452 a.a.     [Download]
>gi|120610159|ref|YP_969837.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSMQNSVNVFAAGHPGQPAGAMPASAPPGGTGAEPGTKPSGLPDVVSGGNPLVAAANTLLNLIPQIRRMA
TNPDPAAFQHYLLECIRHFESRAGGAGVPMETIIGARYCICTAIDEAAAQTPWGGSGVWPQYSLLVALHN
ETWGGEKFFQLLSKLVQTPHQHIDLIELMYFCLMLGFEGRYHVIDNGRSQLESLKARLLQVIESTRGDRS
GALSLHWRGVQRAAVPPWSLVPFWVAAALTLLIGFLIFLWFNYRLASRSDELFAAINAIRLPKMPSVVAV
APPKPRLRQFLEPEIREGLVEVNDQADRSIVTLRGDGLFDPASTEVKPRYVAVIQRIASALNEVSGKVVV
NGYSDNQPIRTARFPSNWHLSQERAQAVAAMLQRTIADGSRLRAEGRAESDPIAPNSTPEGRALNRRVEI
VLMVPPQARDAELQLTPGPAAAGTPAPGNPKN
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1626583-1627941 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGTCCATGCAGAACTCCGTCAACGTTTTCGCCGCCGGCCATCCGGGCCAGCCCGCCGGGGCCATGCCCG
CGTCCGCACCTCCCGGCGGCACCGGTGCCGAGCCCGGCACCAAGCCGTCGGGCCTGCCCGATGTCGTGAG
CGGCGGCAATCCGCTCGTGGCCGCGGCCAATACCCTGCTGAACCTCATTCCGCAGATCCGCCGCATGGCG
ACCAATCCCGATCCCGCGGCATTCCAGCACTACCTGCTCGAATGCATCCGGCATTTCGAGAGCCGGGCGG
GCGGCGCGGGCGTGCCGATGGAAACCATCATCGGCGCGCGCTACTGCATCTGCACCGCGATCGACGAGGC
GGCGGCCCAGACACCGTGGGGCGGTTCGGGCGTCTGGCCGCAGTACAGCCTGCTCGTGGCGCTGCACAAC
GAAACCTGGGGCGGGGAGAAGTTCTTCCAGCTGCTGTCCAAGCTGGTCCAGACGCCCCACCAGCACATCG
ACCTCATCGAGCTCATGTACTTCTGCCTGATGCTCGGCTTCGAGGGACGCTATCACGTCATCGACAACGG
GCGCAGCCAGCTCGAGAGCCTGAAGGCCCGGCTGCTGCAGGTGATCGAGAGCACCCGCGGGGACCGCAGC
GGGGCGCTGTCCCTGCACTGGCGCGGCGTGCAGCGCGCGGCGGTGCCGCCCTGGAGCCTGGTGCCGTTCT
GGGTGGCGGCCGCGCTGACCCTGCTCATCGGCTTCCTGATCTTCCTCTGGTTCAACTACCGGCTGGCATC
GCGCTCGGACGAGCTGTTCGCCGCGATCAATGCCATCCGCCTGCCGAAGATGCCCTCCGTGGTGGCCGTG
GCGCCACCGAAGCCGCGCCTGCGCCAGTTCCTGGAGCCCGAGATCCGCGAAGGCCTGGTCGAGGTGAACG
ACCAGGCGGACCGCAGCATCGTGACCCTGCGCGGAGATGGCCTGTTCGATCCAGCGTCCACCGAAGTCAA
GCCGCGCTATGTCGCGGTGATCCAGCGCATCGCGTCCGCGCTCAACGAAGTGTCCGGCAAGGTGGTCGTG
AACGGCTATTCCGACAACCAGCCGATCCGCACGGCACGCTTCCCTTCGAACTGGCACCTGTCGCAGGAGC
GGGCCCAGGCCGTCGCGGCCATGCTGCAGAGGACCATCGCCGACGGGTCCCGCCTGCGGGCCGAAGGCCG
TGCCGAAAGCGACCCGATCGCCCCCAACAGCACGCCGGAAGGCCGGGCGCTGAACCGCCGGGTGGAGATC
GTGCTGATGGTCCCGCCCCAGGCCCGCGATGCCGAGCTGCAGCTGACTCCCGGCCCGGCTGCGGCCGGCA
CGCCCGCCCCCGGCAATCCGAAGAACTAA