SecReT6
Protein ID: 120610162
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1475
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1632316..1633356 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA1TM78
KEGG IDaav:Aave_1475
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 53..113
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 177..209
Protein Sequence: 346 a.a.     [Download]
>gi|120610162|ref|YP_969840.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MIDIEELLEPTADTPPCGPDLTYDAEFLALETAATGKPEQQFGDTVIPAEPPDWRDVERRARALLVRTKD
ARVAALLCRALTNVQGVRGMSQGVQLMAWMFARYWDGLHPLPEDGDHFMRMNAVSSLNEITGQLRDLRQQ
DFVRLPGGTISVRDAESVARGATAEGGLRISLDQLRVALAQAWQQGDESLRAWSTASEALRSLQTTFRDR
LESTQVPDLEQFQSLLVVLNDLVPHAPIGMADAAAASPEEGAVPGAGAVPAGGVAAGDAGGVAARPAGIR
TRDDALAQLLLVAEFLERTEPTNPAPLLIRRAAKLMGLSFLDILRELSPDSVSQVETITGGQNPPS
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1632316-1633356 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGATCGACATCGAAGAGCTTCTTGAACCCACGGCGGACACGCCGCCCTGCGGGCCGGATCTCACCTACG
ACGCGGAGTTCCTGGCCCTGGAGACCGCGGCCACCGGCAAGCCGGAGCAGCAGTTCGGGGACACGGTGAT
CCCCGCCGAGCCACCGGACTGGCGCGACGTGGAGCGCCGCGCGCGCGCGCTGCTCGTCCGCACGAAGGAT
GCGCGCGTCGCGGCCTTGCTGTGCCGGGCACTGACCAACGTCCAGGGCGTGCGCGGCATGTCGCAGGGCG
TGCAGCTGATGGCCTGGATGTTCGCCCGTTACTGGGACGGCCTGCATCCGCTGCCCGAGGATGGCGACCA
CTTCATGCGCATGAACGCCGTGTCGTCGCTCAACGAGATCACGGGCCAGCTGCGCGACCTCCGCCAGCAG
GACTTCGTGCGCCTGCCCGGCGGCACCATCAGCGTGCGGGACGCGGAGTCGGTGGCGCGGGGGGCGACCG
CCGAGGGCGGCCTGCGGATATCGCTCGATCAGTTGCGGGTGGCGCTGGCGCAGGCATGGCAGCAGGGCGA
TGAGTCGCTGCGGGCCTGGAGCACGGCCAGCGAAGCGCTGCGCAGCCTGCAGACGACGTTCCGCGACCGG
CTGGAAAGCACGCAGGTGCCGGACCTGGAGCAGTTCCAGTCGCTGCTGGTGGTCCTGAACGACCTGGTGC
CGCATGCGCCCATCGGCATGGCCGATGCCGCCGCGGCATCGCCGGAGGAAGGGGCCGTTCCTGGCGCCGG
CGCCGTTCCGGCGGGAGGTGTCGCGGCCGGCGATGCCGGCGGGGTAGCCGCCAGGCCGGCAGGGATCAGG
ACCCGCGACGACGCGCTGGCACAACTGCTGCTGGTGGCCGAATTCCTGGAGCGCACCGAGCCCACCAATC
CGGCGCCGCTGCTGATCCGCCGCGCGGCCAAGCTGATGGGCCTCAGTTTCCTCGACATCCTGAGGGAGCT
TTCTCCAGACAGCGTCAGCCAGGTCGAGACGATCACGGGAGGACAAAATCCGCCATCCTGA