SecReT6
Protein ID: 120610163
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1476
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1633519..1634067 [+]
Producthypothetical protein
NoteTssB
UniProt IDA1TM79
KEGG IDaav:Aave_1476
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-60, Aligned region: 15..166
Protein Sequence: 182 a.a.     [Download]
>gi|120610163|ref|YP_969841.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MVTLSKTGKSGQKFIARNRAPRVQIEYDVEIYGSEKKVQIPFVMGVMADLSGKPVDPLPEIADRKFLDID
IDNFDARMKSIKPRASFNVPNTLTGDGRLHIDLTFESMDDFSPAAIARKVGALNSLLEARTQLHNLLSYM
DGKQGAEELISKVLKDPALLKSLAAMPNRPAGGVTEKTDDAQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1633519-1634067 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGGTGACCTTAAGCAAGACCGGCAAGAGCGGTCAGAAGTTCATTGCCCGCAATCGCGCCCCACGCGTTC
AGATCGAATACGACGTCGAGATCTACGGCTCCGAGAAGAAGGTGCAGATTCCCTTCGTCATGGGCGTGAT
GGCGGACCTCTCCGGCAAGCCGGTGGATCCCCTGCCGGAGATCGCGGACCGCAAGTTCCTCGACATCGAC
ATCGACAACTTCGATGCGCGCATGAAGTCGATCAAGCCGCGCGCGTCCTTCAACGTGCCCAACACGCTGA
CGGGCGATGGCCGCCTGCACATCGATCTGACGTTCGAGAGCATGGACGACTTCTCCCCGGCCGCCATCGC
GCGCAAGGTGGGGGCGCTCAATTCCCTGCTGGAAGCCCGCACCCAGCTGCACAACCTGCTGTCCTACATG
GACGGCAAGCAGGGCGCTGAGGAACTGATCAGCAAGGTGCTGAAGGACCCGGCGCTGCTCAAATCGCTGG
CCGCGATGCCCAACCGGCCCGCCGGCGGCGTGACCGAGAAGACCGACGACGCTCAGTGA