SecReT6
Protein ID: 120610164
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1477
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1634081..1635580 [+]
Producthypothetical protein
NoteTssC
UniProt IDA1TM80
KEGG IDaav:Aave_1477
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.50E-199, Aligned region: 67..492
Protein Sequence: 499 a.a.     [Download]
>gi|120610164|ref|YP_969842.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MNTTTSLDAVQGTQTLEGSEFTSLLQKEFKPKTDQAREAVESAVQTLAQQALAASATLSDDAYQTVQAII
AEIDRKLSEQINLIIHHSDFQQLEGAWRGLHHLVHNTEVDELLKIRVMNISKKELHRNMRRFKGVGWDQS
PIFKKVYEEEYGQFGGEPFGCLVGDYYFDHSPPDVELLGEMAKVSAAAHCPFIAGASPAMMQMDSWQELA
NPRDLTKIFTNTEYAAWRSLRDSDDSKYIGLAMPRFLARLPYGAKTNPVDEFDFEEETAGGDHSKYAWAN
SAYAMAVNINRSFKYYGWCTSIRGVESGGAVDNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDVAAFIGAQSLHKPAEYYDPDATANANLSARLPYMFACCRFAHYLKCIVRDKIGSFKERSDM
ERWLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVAEVEGNPGYYTSKFFLRPHYQLEGLTVSLRLVSK
LPSVKQAGN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1634081-1635580 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAACACGACGACTTCTCTGGACGCGGTGCAGGGCACCCAGACGCTCGAGGGCAGCGAATTCACCTCGC
TGCTGCAGAAGGAATTCAAGCCCAAGACCGACCAGGCGCGCGAGGCGGTCGAATCGGCCGTGCAGACGCT
CGCGCAGCAGGCGCTGGCGGCCTCGGCCACGCTGTCGGACGATGCATACCAGACCGTCCAGGCCATCATC
GCCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCTGATCATCCACCACAGCGATTTCCAGCAGCTCG
AGGGCGCATGGCGCGGCTTGCACCACCTGGTCCACAACACCGAGGTGGACGAGCTGCTCAAGATCCGCGT
GATGAACATCTCCAAGAAGGAGCTGCACCGGAACATGCGCCGCTTCAAGGGCGTGGGCTGGGACCAGAGC
CCGATCTTCAAGAAGGTGTACGAAGAGGAATACGGCCAGTTCGGCGGGGAGCCGTTCGGGTGCCTGGTGG
GCGACTACTATTTCGACCACAGCCCGCCGGACGTGGAACTGCTCGGCGAGATGGCCAAGGTGTCCGCCGC
CGCCCACTGCCCGTTCATCGCCGGCGCGTCTCCCGCGATGATGCAGATGGACTCCTGGCAGGAGCTGGCC
AACCCCCGCGACCTGACCAAGATCTTCACCAACACCGAATATGCCGCGTGGCGCAGCCTGCGCGATTCCG
ACGACTCGAAGTACATCGGCCTGGCGATGCCGCGCTTCCTCGCGCGCCTGCCTTACGGCGCGAAGACGAA
TCCGGTGGACGAGTTCGACTTCGAGGAGGAAACGGCCGGCGGCGACCACAGCAAGTACGCCTGGGCGAAC
TCCGCCTATGCGATGGCCGTGAACATCAACCGCTCGTTCAAGTACTACGGCTGGTGCACCTCGATCCGCG
GGGTGGAGTCCGGCGGCGCGGTGGACAACCTGCCGGCGCACACCTTCCCGACGGACGACGGCGGCGTGGA
CATGAAGTGCCCGACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAATTGGCCAAGAACGGCTTCATG
CCGCTGGTGCACCGCAAGAACTCCGACGTCGCCGCCTTCATCGGCGCGCAGTCCCTGCACAAGCCGGCCG
AATACTACGATCCGGACGCCACGGCGAACGCCAACCTGTCGGCGCGCCTGCCCTACATGTTCGCGTGCTG
CCGCTTCGCGCACTACCTCAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAAGGAGCGCTCCGACATG
GAGCGCTGGCTCAACGACTGGATCATGAACTACGTGGACGGCGACCCGGCCAACTCCTCGCAGGAAACCA
AGGCCCGCAAGCCGCTGGCCGCGGCCGAGGTGCAGGTGGCCGAAGTGGAAGGCAACCCGGGCTACTACAC
GTCCAAGTTCTTCCTGCGCCCGCACTACCAGCTCGAAGGCCTGACCGTGTCCCTGCGGCTGGTGTCGAAG
CTGCCGTCGGTGAAGCAGGCGGGCAACTGA