SecReT6
Protein ID: 120610165
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1478
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1635633..1636490 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDA1TM81
KEGG IDaav:Aave_1478
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.10E-49, Aligned region: 160..282
Protein Sequence: 285 a.a.     [Download]
>gi|120610165|ref|YP_969843.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MAGRAPAAGSPSGEPITIFADHRMQSMNFDFKRPLDRQLAELKDAIRAKPQDAPLRVFYFQVLAVYGEWQ
KALDQLQICAQLDRKAEAMARAYREVILCEVARRDVFAGKRTPNIVGEPPEWLGWMVEGLQCLAEGRAGQ
AAELRAAAFEQAPASAGEIDGEAFEWIADSDARLGPVCELYANGSYYWVPFSSVSQIAFEKPQDLRDLVW
SACELTLHNGGVMHGFIPTRYPGSETAERDEIRLARATEWRDLGDDQATGWGQRVWATDQGDAALLDVRR
VKLSA
 
Nucleotide Sequence: 858 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1635633-1636490 Acidovorax citrulli AAC00-1 chromosome, complete genome
GTGGCGGGGCGCGCCCCTGCCGCCGGTTCCCCCAGCGGAGAACCCATAACTATTTTTGCGGACCACCGCA
TGCAATCCATGAATTTCGATTTCAAGCGCCCGCTGGACCGCCAGCTGGCCGAGCTCAAGGACGCGATCCG
GGCCAAGCCGCAGGATGCGCCGCTGCGGGTGTTCTATTTCCAGGTCCTGGCGGTGTACGGGGAGTGGCAG
AAGGCGCTGGACCAGCTGCAGATCTGTGCCCAGCTGGACCGCAAGGCGGAAGCCATGGCACGTGCCTACC
GGGAGGTGATCCTGTGCGAGGTCGCGCGCCGTGACGTGTTCGCGGGCAAGCGCACGCCCAACATCGTCGG
CGAGCCCCCGGAATGGCTCGGATGGATGGTGGAAGGCCTGCAGTGCCTGGCCGAGGGGCGTGCCGGTCAG
GCCGCGGAACTGCGCGCCGCCGCGTTCGAGCAGGCGCCGGCCTCGGCTGGTGAGATCGACGGCGAGGCGT
TCGAGTGGATCGCCGACTCCGACGCGCGCCTGGGCCCGGTCTGCGAGCTGTACGCCAACGGCAGCTATTA
CTGGGTGCCGTTTTCCAGCGTGTCGCAGATCGCCTTCGAGAAGCCGCAGGACCTGCGCGATCTCGTCTGG
TCGGCCTGCGAGCTCACGCTGCACAACGGCGGCGTGATGCATGGGTTCATCCCCACGCGCTATCCGGGCT
CCGAAACCGCCGAGCGCGACGAGATCCGGCTGGCACGCGCCACCGAATGGCGCGACCTGGGGGACGACCA
GGCGACGGGCTGGGGCCAGCGCGTGTGGGCCACGGACCAGGGCGATGCCGCGCTGCTCGACGTGCGGCGG
GTGAAGCTGTCCGCCTGA