SecReT6
Protein ID: 120610167
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1480
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1637101..1638975 [+]
Producthypothetical protein
NoteTssF
UniProt IDA1TM83
KEGG IDaav:Aave_1480
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.10E-208, Aligned region: 6..623
Protein Sequence: 624 a.a.     [Download]
>gi|120610167|ref|YP_969845.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MNPRLVEYYNRELSYLRELGAEFAAAFPKVAGRLSLRELEVADPYVERLLEGFSFLTARIQMKMDAEFPR
LSQRILEMVCPHYLAPTPSMVVVQMEPSGTEGSLVEGYTLEAGSVIRGRKTAEDQTPCDFRTGHAVTLWP
IDLQQARLGGPPLDLPLSRFGLAEEAAGHLRFTLSVRGAAQWRNLRMDRLDLHISAGDAVASHLQELIHE
SVMGVIVHDPQDASRVWAQLPAESVQPEGYEQSQALLPYTHRAFQGHRLLHEYFAFPARFRFFSIRGLRE
ALDRVPGPQVGITLLLRRAQPTLEAQVDRNKFLLHCVPAINLFERPADRIHVSPGVSEYHVVPDRTRPRD
FEVYSILGVTGHREGQLKDQDFLPFFASVHGLRASEQAYFAVRREPRLFSEHATRFGPRTQYLGSEVFIS
LVDQRAAPFADDLKQLSVRTLCTNRDLPLLMGGKGEQSDFSLVESAPVASVRTVAGPTRPTASIAENEMT
WRLISHLSLNYLAMSDLSEEEGAATLRDLLRLYIDHGDRDLSGQIAAIRSLAIAPVTRRLPQHGQLVYGR
GVGITLGVDEGPLAGVSPWPLASILERFFARHVGVNSYTELSLRSRQRGAVARWKVRPGQRPAA
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1637101-1638975 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAATCCGCGGCTGGTCGAGTACTACAACCGGGAGCTGAGCTACCTGCGCGAACTGGGCGCGGAGTTCG
CTGCCGCCTTCCCGAAAGTCGCCGGGCGGCTGTCGCTGCGCGAGCTGGAGGTGGCCGATCCCTACGTGGA
GCGGCTGCTCGAGGGCTTCAGCTTCCTCACGGCACGCATCCAGATGAAGATGGACGCGGAGTTTCCGCGT
CTCTCGCAGCGCATCCTGGAGATGGTCTGTCCCCATTACCTGGCCCCGACGCCGTCGATGGTGGTCGTGC
AGATGGAGCCCAGCGGCACGGAGGGCAGCCTGGTCGAAGGCTACACCCTGGAGGCCGGCAGCGTGATCCG
CGGGCGCAAGACCGCGGAAGACCAGACGCCGTGCGATTTCCGCACCGGACATGCGGTCACGCTCTGGCCC
ATCGATCTGCAGCAGGCCCGCCTGGGCGGGCCGCCGCTGGACCTGCCGCTGTCGCGTTTCGGACTGGCGG
AAGAGGCTGCCGGCCATCTGCGTTTCACGCTGTCGGTGCGCGGCGCCGCGCAGTGGCGCAACCTGCGCAT
GGACCGGCTCGACCTGCACATCTCCGCGGGGGACGCCGTGGCGTCGCACCTGCAGGAGCTGATCCACGAG
TCCGTCATGGGCGTCATCGTCCACGATCCGCAGGACGCATCCAGGGTCTGGGCCCAGTTGCCGGCGGAGT
CCGTGCAGCCGGAGGGGTACGAGCAGTCCCAGGCCCTGCTGCCCTACACCCACCGGGCATTCCAGGGGCA
CCGGCTGCTGCACGAGTATTTCGCCTTTCCCGCGCGGTTCCGCTTTTTCTCGATCCGGGGGCTGCGGGAG
GCGCTCGACCGCGTGCCGGGCCCGCAGGTCGGCATCACGCTGCTGCTGCGGCGCGCGCAGCCCACGCTGG
AAGCGCAGGTGGACCGCAACAAATTTCTCCTGCACTGCGTGCCGGCGATCAATTTGTTCGAACGCCCGGC
CGACCGCATCCACGTGTCCCCGGGCGTCAGCGAATACCACGTGGTGCCGGACCGGACGCGGCCGCGCGAT
TTCGAGGTCTATTCGATTCTCGGCGTGACAGGCCACCGGGAGGGGCAGCTCAAGGACCAGGATTTCCTGC
CGTTCTTCGCGTCGGTGCACGGCCTGCGCGCGAGCGAACAGGCCTATTTCGCCGTGCGCAGGGAGCCGCG
CCTGTTCTCGGAGCATGCCACGCGTTTCGGGCCGCGCACCCAGTATCTGGGCAGCGAGGTTTTCATCTCG
CTGGTGGACCAGAGGGCAGCGCCGTTCGCGGACGACCTCAAGCAGCTCAGCGTGCGGACGCTGTGCACCA
ACCGCGACCTGCCGCTGCTCATGGGGGGCAAGGGCGAGCAGAGCGACTTCAGCCTGGTGGAGTCCGCGCC
CGTGGCCTCGGTGCGCACGGTGGCCGGCCCGACGCGGCCCACGGCCAGCATCGCCGAGAACGAGATGACC
TGGCGGCTGATCTCGCACTTGTCCCTCAACTACCTGGCGATGAGCGACCTGTCGGAGGAAGAGGGCGCGG
CGACGCTGCGCGATCTGCTGCGGCTCTACATCGACCACGGGGACCGCGACCTGTCCGGGCAGATCGCGGC
GATCCGGTCGCTGGCGATCGCGCCGGTCACGCGCCGGCTGCCCCAGCACGGGCAACTGGTCTATGGCCGC
GGCGTGGGCATCACCCTGGGCGTGGACGAAGGGCCGCTCGCGGGCGTGAGCCCCTGGCCCCTCGCGTCGA
TCCTGGAGCGCTTCTTCGCCCGCCATGTGGGTGTCAACAGCTATACCGAACTGTCGCTGCGGTCGCGGCA
GCGGGGGGCGGTAGCGCGCTGGAAGGTGCGCCCCGGCCAGAGGCCCGCGGCATGA