SecReT6
Protein ID: 120610168
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1481
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1638972..1640138 [+]
Producthypothetical protein
NoteTssG
UniProt IDA1TM84
KEGG IDaav:Aave_1481
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-111, Aligned region: 41..342
Protein Sequence: 388 a.a.     [Download]
>gi|120610168|ref|YP_969846.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSDRVPAQEDSAMPEAGPRPGQGPAPDAGLDASGFWQRLRRDPHPFDLFFALRVLQARSRGHPRFGKALR
PRDEPLRLGQDPSLAFAPATLAEVLPATAGQPERLTVWNFGLYGPNGPLPTHLTEYVRERLRQHDDPTIA
RFSDIFHHRLLLLFFRAWSDTQPVTSLDRPDSDLFGRHLRSLIGYGEASQRDRDTVPDHAKQYLAGHWTR
WTRNPEGLVSALRIFFEVPVELVEFTLHYLELDPEQQTTLSRVPRNARLGVDTVVGSRVPDAQGKFRLRI
GPLPLAQYERFLPGGEDFRALVDWVRNYVGIEFAWDYELILRREDVPPCQLGGSVRLGWTTWSFSGPAQR
DPDDFRLDPELWLASRRRARADAGAGSRAGPVPAAEAS
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1638972-1640138 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGAGCGACCGTGTGCCCGCGCAGGAGGACTCCGCAATGCCGGAGGCGGGACCGCGACCGGGGCAGGGGC
CGGCGCCGGATGCCGGCCTGGATGCGTCGGGGTTCTGGCAGCGCCTGCGGCGCGATCCGCATCCGTTCGA
CCTGTTCTTCGCGCTGCGCGTGCTGCAGGCGCGCAGCCGCGGCCATCCGCGCTTCGGCAAGGCCCTGCGC
CCGCGGGACGAGCCGCTGCGCCTGGGCCAGGACCCGTCGCTGGCCTTCGCGCCCGCGACCCTCGCCGAGG
TGCTGCCGGCCACGGCCGGCCAGCCCGAGCGCCTCACGGTCTGGAACTTCGGCCTCTATGGCCCCAACGG
GCCGCTGCCCACGCACTTGACCGAGTACGTGCGCGAGCGGCTGCGGCAGCACGACGACCCGACGATCGCG
CGCTTCTCCGACATCTTCCACCACCGGCTGCTGCTGCTGTTCTTCCGGGCGTGGTCCGACACGCAGCCAG
TGACCTCGCTCGACCGTCCGGACAGCGACCTGTTCGGGCGCCACCTGCGCAGCCTGATCGGCTATGGCGA
GGCGTCCCAGCGCGACCGCGACACCGTACCGGACCATGCCAAGCAGTACCTGGCGGGCCACTGGACGCGC
TGGACCCGCAATCCCGAAGGCCTGGTGTCGGCCCTGCGGATCTTCTTCGAAGTGCCCGTGGAACTGGTCG
AGTTCACGCTGCATTACCTGGAGCTGGATCCGGAGCAGCAGACCACGCTGTCGCGCGTGCCGCGCAACGC
GCGCCTGGGCGTGGACACGGTGGTGGGCAGCCGGGTGCCCGACGCGCAGGGCAAGTTCCGGCTGCGCATC
GGCCCGCTGCCGCTCGCGCAGTACGAACGCTTCCTGCCGGGCGGCGAAGACTTCCGGGCGCTGGTGGACT
GGGTGCGCAACTACGTCGGCATCGAGTTCGCATGGGATTACGAGCTGATCCTGCGCCGCGAGGATGTCCC
GCCCTGCCAGCTCGGCGGCAGCGTCCGGCTGGGATGGACGACGTGGTCCTTCTCCGGTCCCGCGCAGCGC
GATCCGGACGATTTCCGGCTGGACCCCGAACTGTGGCTGGCATCGCGCAGGCGGGCCCGCGCGGATGCCG
GTGCGGGATCGCGGGCCGGGCCCGTCCCGGCGGCCGAAGCGTCCTAG