SecReT6
Protein ID: 120610169
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1482
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1640211..1642988 [+]
ProductATPase
NoteTssH
UniProt IDA1TM85
KEGG IDaav:Aave_1482
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.10E-40, Aligned region: 233..255
AAA_2 [PF07724], Evalue: 3.10E-40, Aligned region: 655..821
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 233..335
AAA [PF00004], Evalue: 1.70E-18, Aligned region: 661..745
ClpB_D2-small [PF10431], Evalue: 2.00E-15, Aligned region: 829..903
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 233..253
AAA_5 [PF07728], Evalue: 3.20E-13, Aligned region: 660..780
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 34..81
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 210..253
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 480..510
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 641..705
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 725..747
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 800..850
Sigma54_activat [PF00158], Evalue: 1.00E-06, Aligned region: 227..248
Sigma54_activat [PF00158], Evalue: 1.00E-06, Aligned region: 658..776
AAA_25 [PF13481], Evalue: 1.40E-06, Aligned region: 228..293
AAA_25 [PF13481], Evalue: 1.40E-06, Aligned region: 658..687
AAA_19 [PF13245], Evalue: 4.50E-06, Aligned region: 230..257
AAA_19 [PF13245], Evalue: 4.50E-06, Aligned region: 658..682
AAA_22 [PF13401], Evalue: 1.10E-05, Aligned region: 232..253
AAA_22 [PF13401], Evalue: 1.10E-05, Aligned region: 351..394
AAA_22 [PF13401], Evalue: 1.10E-05, Aligned region: 658..683
AAA_22 [PF13401], Evalue: 1.10E-05, Aligned region: 722..747
AAA_22 [PF13401], Evalue: 1.10E-05, Aligned region: 840..861
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 233..278
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 456..496
AAA_17 [PF13207], Evalue: 2.50E-05, Aligned region: 660..698
Clp_N [PF02861], Evalue: 2.60E-05, Aligned region: 29..75
Clp_N [PF02861], Evalue: 2.60E-05, Aligned region: 108..133
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 233..259
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 297..336
NACHT [PF05729], Evalue: 5.30E-05, Aligned region: 660..687
Zeta_toxin [PF06414], Evalue: 5.80E-05, Aligned region: 232..253
Zeta_toxin [PF06414], Evalue: 5.80E-05, Aligned region: 659..700
TIP49 [PF06068], Evalue: 7.70E-05, Aligned region: 233..254
TIP49 [PF06068], Evalue: 7.70E-05, Aligned region: 282..313
TIP49 [PF06068], Evalue: 7.70E-05, Aligned region: 628..695
TIP49 [PF06068], Evalue: 7.70E-05, Aligned region: 813..850
AAA_14 [PF13173], Evalue: 0.00012, Aligned region: 235..313
AAA_14 [PF13173], Evalue: 0.00012, Aligned region: 659..777
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 217..252
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 660..680
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 769..793
AAA_18 [PF13238], Evalue: 0.00057, Aligned region: 233..253
AAA_18 [PF13238], Evalue: 0.00057, Aligned region: 661..692
AAA_18 [PF13238], Evalue: 0.00057, Aligned region: 850..893
AAA_29 [PF13555], Evalue: 0.0025, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.0025, Aligned region: 504..524
AAA_29 [PF13555], Evalue: 0.0025, Aligned region: 658..672
Arch_ATPase [PF01637], Evalue: 0.0033, Aligned region: 212..247
Arch_ATPase [PF01637], Evalue: 0.0033, Aligned region: 284..316
Arch_ATPase [PF01637], Evalue: 0.0033, Aligned region: 659..704
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 221..250
DUF258 [PF03193], Evalue: 0.0074, Aligned region: 659..681
Protein Sequence: 925 a.a.     [Download]
>gi|120610169|ref|YP_969847.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MSEISRQALFGKLNPLLFKSLESATVFCKLRGNPYVELVHWLHQLLQETDSDLIRLLRHFAVDSDRLATD
VLQSLDRLPRGATSISDFSAQIESSIERGWVYATLMYGESQIRSAYWLSGMLRTRVLANELRAISGEFNK
LGEPALSEVFGRVLPDSPESRLKAADGSGLGGVPGEASGATAEAAGPGEALKRYTVDLTERARLQELDPV
TGRDEEVRQMVDILMRRRQNNPILVGEAGVGKTAVVEGLALRIAAGDVPPPLKDVQLRVVDIGLLQAGAS
MKGEFENRLRSLLDEVQASTVPIVLFIDEVHTLVGAGGQAGTGDAANLLKPALARGVLRTIGATTWAEYK
KYIEKDPALTRRFQLVQIHEPDEAKAVHMLRGVAAKLEGHHKVRIGEDAVAAAVTLSHRYIPSRQLPDKA
VSLLDTACSRVALGLHATPARLESVVRQLEALEVEKDIVQRELGLGVGDAGRFADIGTAIERLLAEKAEL
QERFEREKVLVQQIVDAEAALLKPAGKPGAAGAAQAPAPATAPAHASEASGEAGSGGAAAAGTAQGAAVS
PGVATPEALAALRQDLARLQGEDPLLQPVVDASVVAAVVAEWTGIPVGRMVRDEVQSVLTLADTLEKRVI
GQRHGLEAITRRIQTARAQLDNPGKPIGVFLLAGPSGVGKTETALSLAEALYGGEQNLITINMSEYQEAH
TVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHELFFQVFDKGWMEDGEGRYIDFKN
TVIILTSNVGSELIAGMCRDPELAPQPEALAQAVRKPLLEKFPAALLGRLVVVPYYPISDAMLEQIIRLQ
LQRIQTRIAERHGAVLDIDDAAVQLIRQRCTEVESGARMVDGIITQNLLPRLAMRFLQSSVDSKSIRRIR
LGVADSDFAIEYEEA
 
Nucleotide Sequence: 2778 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1640211-1642988 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGTCTGAAATCAGCCGGCAAGCCCTTTTCGGCAAGCTCAATCCCCTGCTCTTCAAGTCGCTGGAAAGCG
CGACCGTGTTCTGCAAGCTGCGCGGCAATCCCTACGTGGAGCTGGTGCACTGGCTGCACCAGCTGCTGCA
GGAGACGGATTCCGACCTGATCCGGCTGCTGCGCCACTTCGCGGTGGATTCCGACCGGCTCGCCACCGAC
GTGCTGCAGAGCCTGGACCGGCTGCCGCGCGGCGCCACGTCGATCAGCGATTTCTCGGCGCAGATCGAAT
CCTCGATCGAACGCGGCTGGGTGTACGCCACGCTGATGTACGGCGAATCGCAGATCCGCAGCGCCTACTG
GCTCTCGGGCATGCTGCGCACGCGCGTGCTGGCCAACGAGCTGCGCGCGATTTCGGGGGAATTCAACAAG
CTGGGCGAGCCTGCCCTGAGCGAGGTGTTCGGCCGCGTGCTGCCGGATTCGCCGGAATCGCGCCTGAAGG
CCGCGGACGGCAGCGGCCTGGGCGGCGTGCCCGGCGAGGCGAGCGGCGCCACTGCCGAGGCGGCCGGGCC
CGGCGAGGCCCTGAAGCGTTACACGGTGGACCTGACGGAGCGCGCGCGCCTGCAGGAACTCGACCCGGTC
ACCGGCCGCGACGAGGAAGTGCGCCAGATGGTGGACATCCTCATGCGCCGGCGTCAGAACAACCCCATCC
TGGTCGGCGAGGCCGGCGTGGGCAAGACGGCGGTGGTGGAAGGCCTCGCGCTGCGCATCGCGGCGGGCGA
CGTGCCGCCACCGCTCAAGGACGTGCAACTGCGCGTGGTGGACATCGGCCTGCTGCAGGCCGGCGCGAGC
ATGAAGGGCGAGTTCGAGAACCGCCTGCGCTCGCTGCTCGACGAGGTGCAGGCCAGCACGGTGCCGATCG
TGCTGTTCATCGACGAGGTGCACACGCTCGTCGGCGCGGGCGGGCAGGCAGGCACGGGCGATGCCGCCAA
CCTGCTCAAGCCGGCGCTGGCGCGCGGCGTGCTGCGCACCATCGGCGCCACCACCTGGGCCGAGTACAAG
AAATACATCGAGAAGGACCCGGCGCTCACCCGGCGCTTCCAGCTCGTGCAGATCCACGAGCCGGACGAGG
CCAAGGCGGTGCACATGCTGCGCGGCGTGGCCGCGAAGCTGGAAGGCCATCACAAGGTGCGTATCGGCGA
GGACGCCGTGGCTGCGGCGGTGACGCTGTCGCACCGCTACATCCCGTCGCGCCAGCTGCCCGACAAGGCC
GTGAGCCTGCTGGACACCGCGTGCTCGCGCGTGGCGCTGGGCCTGCACGCGACGCCGGCGCGGCTGGAGT
CGGTGGTGCGTCAGCTGGAGGCGCTCGAGGTCGAGAAGGACATCGTGCAGCGCGAGCTGGGCCTGGGCGT
GGGCGACGCCGGCCGCTTCGCCGACATCGGCACCGCGATCGAGCGCCTGCTGGCCGAAAAGGCCGAATTG
CAGGAGCGGTTCGAACGCGAGAAGGTGCTGGTGCAGCAGATCGTGGACGCGGAGGCGGCGTTGCTGAAGC
CGGCCGGCAAGCCCGGGGCAGCCGGGGCGGCGCAGGCGCCTGCCCCGGCAACCGCGCCGGCCCATGCATC
GGAGGCCTCCGGAGAAGCCGGCAGCGGCGGGGCGGCTGCCGCCGGTACGGCACAGGGCGCGGCGGTGTCC
CCGGGCGTCGCCACTCCCGAGGCGCTGGCTGCGCTGCGCCAGGACCTGGCGCGCCTGCAGGGCGAAGATC
CGCTGCTGCAGCCCGTCGTGGATGCGAGCGTGGTGGCTGCGGTGGTGGCCGAATGGACGGGCATCCCCGT
GGGCCGCATGGTGCGCGACGAGGTGCAGTCCGTGCTGACGCTCGCCGATACGCTGGAGAAGCGGGTGATC
GGCCAGCGCCACGGCCTGGAGGCGATCACGCGCCGCATCCAGACCGCGCGTGCCCAGCTGGACAACCCCG
GCAAGCCCATCGGCGTGTTCCTGCTGGCCGGGCCCTCGGGCGTCGGCAAGACGGAGACCGCGCTGTCGCT
GGCCGAGGCGCTGTACGGTGGCGAGCAGAACCTCATCACCATCAACATGAGCGAATACCAGGAGGCCCAC
ACGGTCTCCACGCTCAAGGGCGCGCCGCCCGGCTACGTGGGCTACGGCGAAGGCGGCGTGCTGACCGAGG
CCGTGCGCCGCCGCCCCTACAGCGTGGTGCTGCTCGACGAGATCGAGAAGGCCCACCCGGACGTGCACGA
GCTGTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAAGACGGCGAGGGGCGCTACATCGATTTCAAGAAC
ACGGTCATCATCCTGACTTCCAACGTGGGCTCGGAGCTGATCGCCGGCATGTGCCGGGATCCGGAGCTGG
CGCCCCAGCCCGAGGCACTGGCCCAGGCGGTGCGCAAGCCGCTGCTGGAGAAATTCCCGGCCGCGCTGCT
GGGCCGGCTGGTGGTGGTGCCGTACTACCCGATCTCGGACGCGATGCTCGAGCAGATCATCCGCCTGCAG
CTGCAGCGCATCCAGACGCGCATCGCCGAGCGCCACGGCGCCGTGCTGGACATCGACGATGCGGCCGTGC
AGCTCATTCGCCAGCGCTGCACCGAGGTGGAATCCGGCGCCCGGATGGTGGACGGAATCATCACCCAGAA
CCTGCTGCCGCGGCTGGCGATGCGCTTCCTGCAGAGCTCTGTCGATTCGAAGTCGATCCGCCGCATCCGC
CTCGGCGTGGCGGACAGCGATTTCGCCATCGAGTACGAAGAGGCCTGA