SecReT6
Protein ID: 121596549
SecReT6 ID168
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_1600
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]1562142..1562720 [+]
Producthypothetical protein
NoteTssB
UniProt IDA1UYZ1
KEGG IDbmv:BMASAVP1_1600
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.40E-57, Aligned region: 15..166
Protein Sequence: 192 a.a.     [Download]
>gi|121596549|ref|YP_991194.1| hypothetical protein BMASAVP1_1600 [Burkholderia mallei SAVP1]
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLSFVMGVIADLAGKRAEPLPDLPERKFLEID
VDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLDARTELSNLLSYM
DGKHGAEQLIENAINDPALLASLVRQPLAADAEGGARQPVTGTEDDPEIRHE
 
Nucleotide Sequence: 579 bp     [Download]
>gi|121596444|ref|NC_008784.1|:1562142-1562720 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGACGAGCAAGTACAAGGCTTCGGCCAGCGGACAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTCGAGACCTACGGCGCCGAGCGCAAGGTCCAACTGTCGTTCGTGATGGGCGTGAT
CGCGGATCTCGCGGGCAAGCGGGCCGAGCCGCTGCCGGACTTGCCGGAGCGCAAGTTCCTCGAAATCGAC
GTCGACAATTTCGACGAGCGGATGAAATCGATCGCGCCGCGCGTCGCGTTCCAGGTGCCGAACACGCTGT
CGGGAGACGGCATGCTGAGCGTCGACATGACGTTCGAGAGCATCGACGATTTCTCGCCCGCCGCGATCGC
GCGCAACGTCGACGCGTTGCGGCGCCTGCTCGACGCGCGCACCGAGCTGTCGAACCTGCTGTCGTACATG
GACGGCAAGCACGGCGCCGAGCAACTGATCGAAAACGCGATCAACGATCCGGCACTGCTGGCCTCGCTCG
TGCGGCAGCCGCTCGCGGCGGACGCCGAAGGCGGCGCGCGGCAGCCCGTGACCGGCACCGAAGACGACCC
GGAGATTCGCCATGAATGA