SecReT6
Protein ID: 121596609
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0916
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]929105..929686 [-]
Producthypothetical protein
NoteTssE
UniProt IDA1UX12
KEGG IDbmv:BMASAVP1_0916
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-18, Aligned region: 60..170
Protein Sequence: 193 a.a.     [Download]
>gi|121596609|ref|YP_990515.1| hypothetical protein BMASAVP1_0916 [Burkholderia mallei SAVP1]
MDAHETRADAPRNGDEARVRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALTRMQMRGIVQR
DLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVERIIRRVILDFEPRLIAETLVV
APSRAVGAVARPNVLAFEVRGMIRMDPYPIEFMVQSALDLETNQVNITGMRAS
 
Nucleotide Sequence: 582 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c929686-929105 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGGATGCGCATGAGACGCGCGCGGACGCGCCGCGCAACGGCGACGAGGCGCGCGTGCGCGGCGAAGGCC
TCGCGACGCCGCGCCGCGCGAACACGCAACTGCTGCCGACGCTGATCGACCGCCTGCGCGACGACGCGCC
GCAACGGCAGACCGAAGCGCCCGGCGAATATGCGCTCACGCGCATGCAGATGCGCGGCATCGTCCAGCGT
GATCTCGCCTTCCTGCTCAACACGACGAGCATCGACGAGCACATCGATCGCGAACGCCATCCGGCCGCCG
CCGCCTCGACGCTCAACTTCGGCGTGCCGCCGCTTGCCGGCGCGTTTCTCGCGTCGTGCCAGTGGGCCGA
GGTCGAACGCATCATCCGCCGCGTGATTCTCGATTTCGAGCCGCGGCTGATCGCCGAGACGCTCGTCGTC
GCGCCGTCGCGGGCCGTCGGCGCGGTCGCGCGCCCGAACGTGCTCGCGTTCGAGGTGCGCGGCATGATTC
GTATGGATCCCTATCCGATCGAATTCATGGTGCAAAGCGCGCTCGATCTCGAAACGAACCAGGTCAACAT
CACCGGCATGCGCGCGAGCTGA