SecReT6
Protein ID: 121596826
SecReT6 ID168
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_1592
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]1552288..1553604 [+]
Producthypothetical protein
NoteTssL
UniProt IDA1UYY3
KEGG IDbmv:BMASAVP1_1592
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 49..253
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 335..363
DUF2077 [PF09850], Evalue: 3.50E-75, Aligned region: 376..417
OmpA [PF00691], Evalue: 9.90E-15, Aligned region: 250..259
OmpA [PF00691], Evalue: 9.90E-15, Aligned region: 318..416
Protein Sequence: 438 a.a.     [Download]
>gi|121596826|ref|YP_991186.1| hypothetical protein BMASAVP1_1592 [Burkholderia mallei SAVP1]
MNTSSDSFSAGSGGFVPPNPGGAHPAAAPAAGAAAFQPRPGRWAASGTNPLVAAANPLLNLVPQIRSTVH
HPNPAWLREHLVVEIRQFEERAQQAGVASEAIIGARYCLCTALDEAAALTPWGGSVWSSHSLLVSFHNET
WGGEKFFHLLERLSQQPRQHLDLLELLYFCLALGFEGRYRVLDNGRAQLDAVRRQLAQTIRSVRGEFDPA
LSPHWRDVVTRDVTRRFTVPLWVCVALALLVGFGVFAGLRIALAGHSDRLFASIDALHVPKLQPAPPAPH
PAPAPRVAKFLEPEIAAGLVSVRDEADRSVIVLRGDGLFGSGSTSVIDRYMPVLTRVADALNQVQGNVRV
SGYTDDTPVHTARFASNWDLSRERAQAVRSLIAARLDRPERITAEGRGTLDPVAPNDSPANRARNRRVEI
TLMLAPGSDAARATKEAP
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|121596444|ref|NC_008784.1|:1552288-1553604 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAACACTTCTTCCGATTCGTTCTCGGCCGGCTCGGGCGGATTCGTGCCGCCGAATCCGGGCGGCGCGC
ACCCGGCCGCCGCGCCGGCGGCGGGTGCGGCCGCGTTTCAGCCGAGGCCGGGCCGCTGGGCGGCGAGCGG
CACGAATCCGCTCGTCGCGGCCGCGAACCCGCTGTTGAACCTCGTGCCGCAGATCCGTTCGACCGTCCAT
CATCCGAATCCCGCGTGGCTGCGCGAGCATCTCGTCGTCGAGATCCGCCAGTTCGAGGAGCGCGCGCAGC
AGGCGGGCGTCGCCTCCGAGGCGATCATCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCCGC
CGCGCTGACGCCGTGGGGCGGCAGCGTATGGTCGTCGCATAGCCTGCTCGTGTCGTTCCACAACGAGACG
TGGGGCGGCGAGAAGTTCTTCCATCTGCTCGAGCGGCTGTCGCAGCAGCCGCGCCAGCATCTCGACCTGC
TCGAGCTGCTGTACTTCTGCCTCGCGCTCGGCTTCGAGGGGCGCTACCGCGTGCTCGACAACGGCCGCGC
GCAGCTCGACGCGGTGCGCCGCCAGCTCGCGCAGACGATCCGCTCGGTGCGCGGCGAATTCGATCCGGCG
CTCTCGCCGCATTGGCGCGACGTCGTCACGCGCGACGTCACGCGGCGCTTCACGGTGCCGCTGTGGGTGT
GCGTCGCGCTTGCGCTGCTCGTGGGCTTCGGCGTGTTCGCGGGGCTGCGCATCGCGCTCGCCGGCCATTC
GGATCGGCTGTTCGCGTCGATCGACGCGCTGCACGTGCCGAAGCTGCAGCCGGCGCCGCCCGCGCCGCAT
CCGGCGCCCGCGCCGCGCGTCGCGAAGTTCCTCGAGCCGGAGATCGCCGCGGGGCTCGTGAGCGTGCGCG
ACGAGGCCGACCGCAGCGTGATCGTGCTGCGCGGCGACGGCCTGTTCGGCTCCGGCTCGACGTCGGTGAT
CGATCGCTACATGCCGGTGCTCACGCGCGTGGCCGACGCGCTGAACCAGGTGCAGGGCAACGTGCGCGTG
AGCGGCTACACCGACGACACGCCGGTGCACACCGCGCGCTTCGCGTCGAACTGGGATTTGTCGCGCGAGC
GCGCGCAGGCGGTCCGCAGCCTGATCGCCGCGCGGCTCGACCGCCCCGAGCGGATCACCGCCGAAGGGCG
CGGCACGCTCGATCCCGTCGCGCCGAACGATTCGCCCGCGAACCGCGCGCGCAACCGGCGCGTCGAGATC
ACGCTGATGCTCGCGCCCGGCAGCGACGCCGCGCGCGCGACGAAGGAGGCGCCCTGA