SecReT6
Protein ID: 121596950
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0912
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]922601..924928 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA1UX08
KEGG IDbmv:BMASAVP1_0912
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-83, Aligned region: 36..361
Phage_GPD [PF05954], Evalue: 1.10E-83, Aligned region: 596..642
Phage_base_V [PF04717], Evalue: 1.50E-21, Aligned region: 299..316
Phage_base_V [PF04717], Evalue: 1.50E-21, Aligned region: 400..492
Protein Sequence: 775 a.a.     [Download]
>gi|121596950|ref|YP_990511.1| Rhs element Vgr protein [Burkholderia mallei SAVP1]
MPNFSAARTVTVSGPAVPTTPVGEPALELSAIRGDETLSEIYSYTLDCLTPPDPLLAHERAANLDLKAMI
GKALTVTVQLEGMGSFVPGMPGMAGAANIGAGAREISGIVTGARFEGQLNRQCRYRLTMRPWIYLADLRS
DYRIFQNRSVDEIVDEVLNAYSYSYDKRLSGRYPKLGYQVQYGETDFAFIQRLMQEHGIYWFFEHTNQVH
RMVLVDHLGAHKPVESAAYRTLRYYPPGHKIDAEYIDRFSTEEHIRPGRWATGDFDFEKPNADLGVENAL
PRDTAHNGLERYEWPGDYTAREHGEHLARVRMEQTRARGERASGGGNVRDIVCGTTFALAGHPHASANRE
YLVIGATFEATETVGASGPGAYRIDTSFVAQPATTAFRPPRTVRKPRTRGPQTAIVTGPRGQDIWTDQYG
RVKLKFHWDRSLVDDQNSSCWVRVSYAWSGNNYGGVNIPRVGSEVVVDFEHGDPDRPLVTGQVYNALHMP
PWPLPENATQSGFMTRSPAGGGENANMLRFEDKAGEEQVKLHAERNYDVSVERDATTAVGRKHLTLVGVD
LMPVMSTRSPLERLIDLLRTGGAASPAASGQPAAASRQPSGQQQQHQQQHQQHQRQHQPYQQLKQQRQMQ
RAGGWQALAANVAKTLQEIVAVLTDPFVTASVSTVQGASTSVVFGDAKGVHVGDTVKITSGDAHSEVNGT
ASSKDVNSVSLKGTSTSLTGVSTSETGTNIVTTGLTVSTTGASVSTTGFSATETLVQVAKKTQECEFIKG
IKISM
 
Nucleotide Sequence: 2328 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c924928-922601 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCCGAATTTTTCCGCCGCCCGCACCGTGACGGTGAGCGGCCCTGCCGTGCCGACGACGCCCGTCGGCG
AGCCCGCGCTCGAACTGAGCGCGATCCGGGGCGACGAAACGCTATCGGAAATCTATTCGTACACGCTTGA
TTGCCTGACGCCGCCGGACCCGTTGCTCGCGCACGAGCGGGCCGCGAATCTCGATCTGAAGGCGATGATC
GGCAAGGCGCTGACCGTAACCGTGCAGCTCGAAGGCATGGGCTCGTTCGTGCCCGGCATGCCGGGCATGG
CGGGCGCGGCCAATATCGGCGCGGGCGCGCGCGAGATCAGCGGCATCGTGACCGGCGCGCGCTTCGAGGG
CCAACTGAACCGGCAGTGCCGCTACCGGCTGACGATGCGGCCGTGGATCTACCTGGCCGACCTGCGCTCG
GACTACCGGATTTTCCAGAACCGGAGCGTCGACGAGATCGTCGACGAAGTGCTGAACGCGTATTCGTACT
CGTACGACAAGCGCTTGAGCGGCCGGTATCCGAAGCTCGGCTACCAGGTGCAGTACGGCGAGACCGATTT
CGCGTTCATCCAGCGGCTGATGCAGGAGCACGGCATCTACTGGTTTTTCGAGCATACGAACCAGGTGCAC
CGGATGGTGCTCGTCGATCACCTGGGCGCGCACAAGCCGGTGGAGAGCGCCGCATACCGCACGCTGCGCT
ACTACCCGCCGGGGCACAAGATCGACGCCGAGTACATCGACAGGTTCAGCACCGAGGAGCACATCCGGCC
GGGCCGCTGGGCGACGGGCGATTTCGATTTCGAGAAGCCGAACGCGGACCTGGGCGTCGAGAACGCGCTG
CCGCGGGACACCGCGCACAACGGGCTCGAACGTTACGAGTGGCCGGGCGACTACACGGCGCGCGAGCACG
GCGAGCACCTCGCGCGCGTGCGCATGGAACAGACGCGCGCGCGGGGCGAGCGCGCATCGGGCGGCGGCAA
CGTGCGCGACATCGTGTGCGGCACGACATTCGCGCTCGCGGGCCATCCGCACGCGAGCGCGAACCGCGAG
TATCTGGTGATCGGCGCGACGTTCGAGGCGACGGAGACGGTCGGCGCGTCGGGGCCGGGCGCATATCGGA
TCGACACGTCGTTCGTCGCGCAGCCGGCGACCACCGCGTTCCGGCCGCCGCGCACGGTGCGCAAGCCGCG
CACGCGCGGGCCGCAGACGGCGATCGTCACCGGCCCGCGAGGGCAGGACATCTGGACGGACCAGTACGGC
CGTGTGAAGCTGAAATTCCACTGGGACCGTTCGCTCGTCGACGATCAGAACTCGTCGTGCTGGGTGCGCG
TTTCCTATGCGTGGTCGGGCAACAATTACGGCGGCGTCAATATTCCGCGTGTGGGCTCCGAAGTGGTCGT
CGATTTCGAGCACGGCGACCCGGACCGGCCGCTCGTGACGGGGCAGGTATACAACGCGCTGCACATGCCG
CCGTGGCCGTTGCCGGAGAACGCGACGCAAAGCGGCTTCATGACGCGCTCGCCCGCGGGCGGCGGCGAGA
ACGCGAACATGCTGCGCTTCGAGGACAAGGCGGGCGAGGAGCAGGTCAAGCTGCATGCGGAGCGCAATTA
CGACGTATCGGTCGAGCGCGACGCGACGACTGCCGTCGGGCGCAAGCACCTGACGCTCGTCGGCGTCGAC
CTGATGCCGGTGATGTCGACGCGCTCGCCGCTGGAGCGGCTGATCGACCTGCTGCGCACGGGCGGCGCGG
CCAGCCCGGCGGCGTCGGGGCAGCCGGCGGCGGCTTCCCGGCAACCGTCGGGACAGCAGCAGCAACATCA
ACAGCAACACCAGCAACATCAGCGGCAACACCAGCCCTATCAGCAGTTGAAGCAGCAGCGCCAGATGCAG
CGCGCGGGCGGATGGCAGGCGCTCGCGGCGAACGTCGCGAAGACGTTGCAGGAAATCGTGGCGGTGCTCA
CGGACCCGTTCGTCACCGCGTCGGTGAGCACCGTGCAGGGCGCGTCGACGTCCGTCGTGTTCGGCGACGC
GAAGGGCGTGCACGTGGGCGATACCGTCAAGATCACCAGCGGAGACGCGCATTCGGAGGTCAACGGCACG
GCATCGTCGAAGGACGTGAACAGTGTCTCGCTGAAGGGCACGTCGACCAGCCTGACCGGGGTCAGCACCT
CCGAAACGGGGACGAACATCGTGACGACCGGACTCACGGTATCAACGACCGGCGCGAGCGTTTCGACGAC
CGGATTCAGTGCGACCGAAACGCTCGTGCAGGTCGCCAAGAAGACGCAGGAATGCGAATTCATCAAGGGC
ATCAAGATCTCGATGTGA