SecReT6
Protein ID: 121596990
SecReT6 ID168
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_1591
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]1550869..1552272 [+]
Producthypothetical protein
NoteTssK
UniProt IDA1UYY2
KEGG IDbmv:BMASAVP1_1591
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.60E-159, Aligned region: 30..466
Protein Sequence: 467 a.a.     [Download]
>gi|121596990|ref|YP_991185.1| hypothetical protein BMASAVP1_1591 [Burkholderia mallei SAVP1]
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQIDRELLALGK
VALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGAGGNGEGHGGDGNA
HAGFARYVVREYEVADANEVALGPALLQTGRLNVRLMLESELTGDWQALGVARVVERRTDGRLLVDDGYI
PPRLVAQRDPVLLRHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAA
HPETLFCDWLKLACDLSTFTAAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGN
GMKVATIADPALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQI
PYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|121596444|ref|NC_008784.1|:1550869-1552272 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAACGAGCCGGTATTGTCCGCGACCCCCGCTGCGGCGTTGCGCCAGCGCGTGATCTGGACCGAGGGCA
TGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAGCGGCACTGGGAGCGCTACGTCGGCATGCGCTGCCT
GCCGCTGCAAGGCTTCTACTGGGGCTACGACGAGTTGCAGATCGATCGCGAGCTGCTCGCGCTCGGCAAG
GTCGCGCTGCTCGCCGCGACCGGCGTGATGCGCGACGGCACGCCGTTCGACCTGTCGCATCCGGACGACC
GGCCCGAGCCGCTCGACGTGCCCGCCGACGCGAAGGATCAGCTCGTCGTGCTCGCGCTGCCGCTGTGGCG
CGGCGGCGCGCAGGAGGTGTCGTTCGGCGCGGGCGGCAACGGCGAAGGCCACGGCGGCGACGGCAACGCG
CACGCGGGCTTCGCGCGCTACGTCGTGCGCGAATACGAAGTCGCCGACGCGAACGAGGTCGCGCTCGGCC
CCGCGCTATTGCAGACCGGCCGCCTGAACGTGCGCCTGATGCTCGAATCCGAATTGACGGGCGACTGGCA
GGCGCTCGGCGTCGCGCGCGTCGTCGAGCGGCGCACCGATGGGCGGCTGCTCGTCGACGACGGCTACATT
CCGCCGCGGCTTGTCGCGCAGCGCGATCCGGTGCTGCTGCGCCACACGCGCGAGCTGCACGGGCTGCTCA
CGCAACGCAGCGAGGCGCTCGGCGAGCGCCTGTCGGAGCCGGGGCGCGGCGGCGTGTCCGAAGTCGCCGA
TTTCCTGCTGCTGCAACTCGTCAACCGCTATCTGGCGCTCACGTGGCACGCGCAGCAGGATGTCGCCGCG
CACCCGGAGACGCTGTTCTGCGATTGGCTGAAGCTCGCGTGCGACCTGAGCACGTTCACCGCGGCCGGCC
GCCGGCCGCAGTCGCTCGCGGTCTACCGGCACGACGATCTGCGCGCGAGCTTCGGCGAGCTGATGGCCGA
GCTGCGCCGCTCATTGTCGACGGTGCTCGAGCAGAACGCGATCCAGATCGAGCTGCGCGACGTGGGCAAC
GGCATGAAGGTCGCGACGATCGCCGATCCGGCGCTGCGCGACACCGCGGGCTTCGTGCTCGCCGTGCGCG
CCGACGTGCCGGCCGACAGCCTGCGCGCGCGCTTTCCCGCGCAGGCGAAGCTCGGTCCCGTCGAGCGCAT
TCGCGATCTCGTGCAGTTGCAACTGCCGGGCATCGCGATGCGGCAGTTGCCCGTCGCGCCGCGGCAGATT
CCGTATCACGCGGGCCACACGTACTTCGAGATCGACAAGGGCGGCGAGATGTGGAAACAGCTCGAACGCT
CGGGCGGCCTCGCATTTCATTTCGCCGGCGAATTCCCGGGACTCTCGATGGAGTTCTGGGCGATTCGCGG
GTGA