SecReT6
Protein ID: 121597169
SecReT6 ID168
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_1605
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]1567224..1568702 [+]
Producthypothetical protein
NoteTssG
UniProt IDA1UYZ6
KEGG IDbmv:BMASAVP1_1605
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.50E-130, Aligned region: 81..439
Protein Sequence: 492 a.a.     [Download]
>gi|121597169|ref|YP_991199.1| hypothetical protein BMASAVP1_1605 [Burkholderia mallei SAVP1]
MTTNPKPEPAGVDAGSHANSNAGRRAGAAANVEANAEPDAMPNAVRGAAADVAPSAAPSATPSATSQAAA
ARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVRDDGP
RPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSLDRPA
RARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLPDSLPDSPPDSSPDSPPDSRSDSPSDARLDP
HPDSPRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRP
TQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFLPGGVHARQLAQWVREYVGIEFDWDVQLELARGEV
PTLALGSRHGLGRTAWLGERLDPGPARDLVLGYDERMRASRARSGAADQAAAAGALIANLPEREPPCPIS
AE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|121596444|ref|NC_008784.1|:1567224-1568702 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGACGACGAACCCGAAACCGGAGCCCGCCGGCGTGGACGCGGGCTCGCACGCGAACTCGAATGCGGGCC
GGCGCGCCGGTGCGGCCGCGAATGTGGAGGCGAACGCGGAGCCGGACGCGATGCCGAATGCAGTCCGGGG
CGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCGAGCGCGACGTCGCAGGCCGCCGCC
GCGCGCCGCGACGCATGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGTTTCATGCGCTGC
GTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCGCGACGAGCCGGT
GCGCTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGTGACGACGGCCCG
CGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGTCGCATCTGACCG
AGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGACCTGTTTCATCA
TCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTCGATCGGCCGGCG
CGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTGCCGATTCACCGC
GCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCTGATTCACTGCCTGATTCACC
GCCTGATTCATCGCCTGATTCGCCGCCTGATTCGCGGTCCGATTCGCCGTCCGATGCGCGCCTCGATCCG
CATCCCGACTCGCCGCGCGGCGCTGGCGCGCTCGCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGG
TGCGGCACACGCGCAACCCGGAGGGGCTCGTGCAGATCCTGCGGCGCTATTTCGGTGTGCGGGTACGCAT
CGTCGAGCACGTGCCGCACTGGGTGATGCTCGATCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCG
ACGCAGCCGCTCGGCGGCGCCGTGCTCGGCCGTGCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGC
TCGGCCCGCTGACGCTCGACGAATACCGGCGGTTCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCA
ATGGGTGCGCGAATACGTCGGCATCGAATTCGACTGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTG
CCGACGCTCGCGCTCGGTAGCCGTCACGGGCTCGGCCGCACCGCATGGCTCGGCGAGCGGCTCGACCCCG
GCCCCGCGCGCGACCTCGTGCTCGGCTACGACGAGCGCATGCGCGCTTCGCGCGCACGATCGGGCGCGGC
CGATCAGGCGGCCGCCGCCGGTGCGTTGATCGCCAACCTGCCTGAACGGGAACCGCCATGTCCGATATCG
GCCGAGTGA