SecReT6
Protein ID: 121597320
SecReT6 ID168
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_1601
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]1562713..1564221 [+]
Producthypothetical protein
NoteTssC
UniProt IDA1UYZ2
KEGG IDbmv:BMASAVP1_1601
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-194, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|121597320|ref|YP_991195.1| hypothetical protein BMASAVP1_1601 [Burkholderia mallei SAVP1]
MNERAQTQADTRAAAQPVVARDEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTVGMTTDAYGSVK
QIIAEIDRKLSEQINLILHHQEFQTLEGAWRGLHYLVTNTETDELLKIKALPASRNELARTLKRYKGVAW
DQSPLFRKVYEEEYGQFGGEPFGCLVGDFHFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELANPRDLTKIFQNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTGAASHDRYT
WANSAYAMAANINRSFKLYGWCSSIRGVESGGAVQGLPCHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAQVVVEEIDDNPGYYASKFFLRPHYQLEGLTVSLRL
ISKLPSAKAAGE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|121596444|ref|NC_008784.1|:1562713-1564221 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAATGAACGTGCCCAAACCCAGGCCGACACGCGCGCCGCCGCCCAGCCCGTGGTCGCGCGCGACGAGT
TCGCCGCGCTGCTGCAAAAGGAGTTCAAGCCGAAGACGGCGGAGGCGCGCGAATCGGTCGAGCGCGCGGT
GCGCACGCTCGCGCAGCAGGCGCTCGAGCACACGGTCGGCATGACGACCGACGCTTACGGCAGCGTCAAG
CAGATCATCGCCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCTGATCCTGCATCATCAGGAGTTCC
AGACGCTCGAAGGCGCGTGGCGCGGCCTGCACTACCTCGTCACGAACACCGAGACCGACGAGCTGCTGAA
GATCAAGGCACTGCCCGCGTCGCGCAACGAGCTCGCGCGCACACTCAAGCGCTACAAGGGCGTCGCGTGG
GATCAGAGCCCGCTGTTTCGCAAGGTCTACGAAGAAGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTCGTCGGCGATTTCCATTTCAACCACAGTCCGCCCGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCGGCGGCCGCGCATGCGCCGTTCATCGCGGGCGCGTCGCCCGAGCTGATGCAGATGGATTCGTGGCAG
GAGCTCGCCAATCCGCGTGATCTGACGAAGATCTTCCAGAACACCGAATACGCCGCGTGGCGCAGCCTGC
GCCAGTCCGAGGATTCGCGCTACGTCGGGCTCGCGATGCCGCGCTTTCTCGCGCGGCTGCCGTACGGCGC
GCGCACGAATCCCGTCGACGAATTCGACTTCGAGGAGGATACCGGCGCCGCGAGCCACGACCGCTACACG
TGGGCGAATTCCGCGTACGCGATGGCGGCGAACATCAACCGCTCGTTCAAGCTGTACGGCTGGTGCTCGT
CGATCCGCGGCGTCGAATCGGGCGGCGCGGTGCAAGGGCTGCCGTGCCACACGTTCCCCACCGACGACGG
CGGCGTCGACCAGAAATGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAGAAC
GGCTTCATGCCGTTCGTACATCGAAAGAATTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGCTGTATC
AGCCCGCCGAGTATCACGATCCCGACGCGACCGCGAACGCGCGGCTCTCGGGCCGCCTGCCGTACCTGTT
CGCGTGCTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTTCGCGAGCGC
GACGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGATCCGGCGAACTCGTCGC
AGGAGACGAAGGCGCGCAAGCCGCTCGCGGCCGCGCAGGTCGTCGTCGAGGAGATCGACGACAACCCCGG
CTATTACGCGTCGAAATTCTTCCTGCGGCCGCATTACCAGCTGGAAGGGCTCACCGTGTCGCTGCGGCTC
ATCTCGAAGCTGCCGTCGGCGAAGGCGGCGGGCGAATGA