SecReT6
Protein ID: 121597454
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0921
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]934846..935427 [+]
Producthypothetical protein
NoteTssB
UniProt IDA1UX17
KEGG IDbmv:BMASAVP1_0921
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.80E-59, Aligned region: 11..164
Protein Sequence: 193 a.a.     [Download]
>gi|121597454|ref|YP_990520.1| hypothetical protein BMASAVP1_0921 [Burkholderia mallei SAVP1] [TssB]
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADRRFLDIDIDNF
DERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLRQLLEARTQLANLQTYMDDKS
GAETLVNQLLQDPALLRSLAAAPKPQLAGGPDAGNARGAKDAPDTANHDSDAA
 
Nucleotide Sequence: 582 bp     [Download]
>gi|121596444|ref|NC_008784.1|:934846-935427 Burkholderia mallei SAVP1 chromosome II, complete sequence [TssB]
ATGTCCGCATCCAGCAGCTCTCAAAAATTCATCGCGCGCAACCGCGCGCCCCGCGTGCAGATCGAATACG
ACGTCGAAGTCTACGGCTCGGAAAAGAAGGTCGAACTGCCGTTCGTGATGGGCGTGCTCGCCGACCTGTC
GGGCAAGCCGGTCGCGCCGCTGCCCGCCGTCGCCGACCGGCGCTTCCTCGACATCGACATCGACAACTTC
GACGAGCGGATGAAGGCGATCAAGCCGCGCGTGGCGTTCGCGGTGGACAACACGCTGTCGGGCGACGGGC
AGCTGATGGTCGACATGACGTTCGAAAGCATCGAGGACTTCTCGCCCGCCGCGATCGCGCGAATGGTCGG
CCCGTTACGGCAATTGCTCGAGGCGCGCACGCAGCTCGCGAACCTGCAGACCTACATGGACGACAAATCG
GGCGCCGAGACGCTCGTCAACCAGTTGCTGCAGGACCCGGCGCTGCTGCGCTCGCTCGCGGCCGCGCCGA
AGCCGCAGCTCGCTGGCGGGCCGGACGCGGGCAATGCGCGCGGCGCGAAGGACGCGCCCGACACGGCGAA
CCACGACAGCGATGCGGCCTGA