SecReT6
Protein ID: 121597466
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0917
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]929673..930638 [-]
Producthypothetical protein
NoteTagJ
UniProt IDA1UX13
KEGG IDbmv:BMASAVP1_0917
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.60E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|121597466|ref|YP_990516.1| hypothetical protein BMASAVP1_0917 [Burkholderia mallei SAVP1]
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQGERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFHARVMAGQARPGFVFDAPPWIDDLLEALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFSDLAGWRLARPGVLLALVWAPCVLTLADGSV
AHGFMPARYPGSELADGGGAPGASAAAHEADAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c930638-929673 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGACGACGCCTGCCTTCCCGGCGCCGCCCGGCGCACGCACGTCGGCCCGGCCGCACGATACGCCGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGGGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCACGCCCGCG
TGATGGCGGGCCAGGCGCGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCTGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTTCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCTGCTCGCTCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCAGCGCGTTACCCGGGCTCCGAACTGGCCGACGGGGGCGGCGCGCCGGGCGCCT
CAGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGCGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA