SecReT6
Protein ID: 121597485
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0925
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]937670..938173 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA1UX21
KEGG IDbmv:BMASAVP1_0925
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-40, Aligned region: 14..160
Protein Sequence: 167 a.a.     [Download]
>gi|121597485|ref|YP_990524.1| hypothetical protein BMASAVP1_0925 [Burkholderia mallei SAVP1]
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYELKTDGAFNAAD
FFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGTLGVVAAYRDLPNSVWRAAYPLPPARDAA
WYRFSSPKLKLTIELDTHAIRITEPGK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|121596444|ref|NC_008784.1|:937670-938173 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCATCCGACCACCCCCGTTGCCGCCGTCGCGCTCGCGCTCGCGTGCGCCGCGTGCGCGAGCGGCGCGG
CCAAGCAGAAGGAGCCGCTGCGGCTCGAGCTCGCCGTGCGCGCCGCGCCCACGGTCAATCCGGACGATCG
GAGCCGGCCGGCTCCGATCGTCGTGAGCGTCTACGAGCTGAAGACCGACGGCGCATTCAACGCCGCCGAT
TTCTTCACGCTGCAGGGCCCGGACAAGACCGTGCTCGCCGACGATCTGCTCGCGCGCGAGCGTTTTCAAC
TGCGCCCCGGCGAGCGCCGCGTGATCCGGCGCGACGCCGATCCGGCGGCGGGCACGCTCGGCGTGGTCGC
CGCGTACCGCGATCTGCCGAACTCGGTGTGGCGCGCGGCATATCCGCTGCCGCCCGCGCGGGACGCCGCA
TGGTATCGCTTCTCGTCGCCGAAGCTGAAGCTGACCATCGAGCTCGACACGCACGCGATCAGGATCACCG
AACCCGGAAAATGA