SecReT6
Protein ID: 121597728
SecReT6 ID168
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_1603
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]1564791..1565351 [+]
Producthypothetical protein
NoteTssE
UniProt IDA1UYZ4
KEGG IDbmv:BMASAVP1_1603
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-22, Aligned region: 50..164
Protein Sequence: 186 a.a.     [Download]
>gi|121597728|ref|YP_991197.1| hypothetical protein BMASAVP1_1603 [Burkholderia mallei SAVP1]
MNDDVRAAGGGAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGE
DGFVDWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAA
GERRHNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 561 bp     [Download]
>gi|121596444|ref|NC_008784.1|:1564791-1565351 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAATGACGACGTGCGAGCCGCGGGCGGCGGAGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGC
CGGCGCTGCTCGACCGGCTGACCGACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGAT
CGGCGGCGAGCGCTTGCGCGCGGCGGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAG
GACGGCTTCGTCGACTGGTCGGCGTTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGC
TCGTCGGCAAGCCGATGTCGGGCGTCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCG
TTTCGAGCCGCGTATCGCGCCCGACAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCG
GGCGAGCGCCGGCACAACGTGCTGATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCG
AGTTCGTGCTGCGCTCGGACCTCGATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTG
A