SecReT6
Protein ID: 121597834
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0919
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]931887..932543 [+]
Productchaperone, ATP-binding subunit
NoteTssH
UniProt IDA1UX15
KEGG IDbmv:BMASAVP1_0919
PDB IDNA
Domain hit(s) vs Pfam Clp_N [PF02861], Evalue: 0.00033, Aligned region: 28..74
Clp_N [PF02861], Evalue: 0.00033, Aligned region: 111..130
Protein Sequence: 218 a.a.     [Download]
>gi|121597834|ref|YP_990518.1| chaperone, ATP-binding subunit [Burkholderia mallei SAVP1]
MAISRQALFGKLGATLFRAIESATVFCKLRGNPYVELVHWLQQLLQQSDSDLHRIVRHAGIERDALDRDI
ARALAALPAGAGSISDFSHHVETAIERAWVLATLRFGDRRIRGAWLVAALVDTPELRRVLLSISPAFARI
PHDDALDDVLPAWTAGSPEAADAPYDHVDSAPASPGEPSGATRAAPNGSPLERYCTDLTARATATSPPSS
GASSKSAR
 
Nucleotide Sequence: 657 bp     [Download]
>gi|121596444|ref|NC_008784.1|:931887-932543 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGGCGATCTCGCGTCAGGCGCTGTTCGGGAAACTCGGGGCTACGCTCTTCAGGGCGATCGAATCGGCCA
CGGTTTTCTGCAAGCTGCGCGGCAATCCGTACGTCGAGCTGGTGCACTGGCTGCAGCAGTTGTTGCAGCA
GTCCGACTCCGATCTGCACCGGATCGTGCGGCACGCCGGCATCGAGCGCGACGCGCTCGATCGCGACATC
GCGCGCGCGCTCGCCGCGCTGCCGGCCGGCGCGGGCTCGATCAGCGATTTTTCCCATCACGTCGAAACCG
CGATCGAGCGCGCATGGGTGCTCGCAACGCTGCGCTTCGGCGACCGGCGCATCCGCGGCGCATGGCTCGT
CGCCGCGCTCGTCGATACGCCGGAACTGCGGCGCGTGCTGCTTTCCATTTCGCCGGCGTTCGCGAGGATT
CCTCACGACGATGCTCTCGACGACGTGCTGCCCGCGTGGACGGCCGGTTCGCCGGAAGCGGCGGACGCGC
CGTACGACCACGTCGATTCCGCGCCCGCTTCGCCGGGCGAGCCGTCCGGCGCGACGCGCGCCGCGCCGAA
CGGCTCGCCGCTCGAGCGATATTGCACGGACCTGACCGCGCGCGCGACGGCGACATCGCCCCCGTCATCG
GGCGCGAGCTCGAAATCCGCACGATGA