SecReT6
Protein ID: 121597925
SecReT6 ID168
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_1607
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]1571332..1573536 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA1UYZ8
KEGG IDbmv:BMASAVP1_1607
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 23..325
Phage_GPD [PF05954], Evalue: 1.50E-85, Aligned region: 581..641
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 364..456
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 510..525
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 530..547
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 581..603
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 646..664
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 715..727
Protein Sequence: 734 a.a.     [Download]
>gi|121597925|ref|YP_991201.1| Rhs element Vgr protein [Burkholderia mallei SAVP1]
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESERHLNGI
VARAALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLGTYGFPIENHLTDTYAPRDY
CVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDS
WLPAQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAE
HERALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLP
YRSPRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHSNAFRFEDKKG
AEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQNETVNIGKHRVAQIGGNETH
GVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTETIGQGKTLNVTQHYQTTSKSMKTAVAEHHA
EEIGSRTSTIEKAHELNVGGSQSVNVGASHTMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTV
ESSASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|121596444|ref|NC_008784.1|:1571332-1573536 Burkholderia mallei SAVP1 chromosome II, complete sequence
GTGACCCGCGTGTTCACACTCGACAGCCTGCACGGCGACGACCTGAAGTTCCACCGGCTCTACGGCGAGG
AAGCGCTCGGGCGGATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGA
ACTGCTCGGCAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGAGCGCCATCTGAACGGGATC
GTCGCGCGCGCCGCGCTGGTCGGGCGGCGCGCGGAGCGGCATTACGGCTATCAACTGATCGTGCGGCCGT
GGCTGTGGCTCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAGATCGTGCA
GGACGTGCTCGGCACGTACGGCTTTCCGATCGAAAACCATCTGACCGACACGTACGCGCCGCGCGACTAC
TGCGTGCAGTACAACGAGACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACT
ACTTCAAGCACGCCGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCC
GGGCTACGAGCACATTCCGTTCATCGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGACAGC
TGGCTGCCCGCGCAGGAAGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCG
CGGATCTGTCCGCGCAGAAGATCGATCCGCGCGGCCACGACCATGACGGCTTCGCGTCGTTCGAATGGCC
CGGCGGCTATCGCGACGATGAACCGGGCGCGCATTACAGCCGCGTGCGGCTCGAAGAGCAGCAGGCGGAG
CACGAACGCGCGCTCGCGCGCACCGACGTGCGCGGCATCGCACCCGGCTATCTGTTCACGCTCGAACACT
GCCCGCGCGCCGACCAGAACCGCGAATACCTGATCGTGCGCTGCCAGTATCGGTTTCAGGAGAACGCGTA
CGCGACCGATAGCGGCAACGAGGCGGTCGTGCACGAATCTCAGACACTCGTGCAGCCTTCGAGCCTGCCG
TATCGCTCGCCGCGCGCGACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGA
AGGGCGAGGAAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGCTGGGACCGCTACGGGCA
GAGCGACCAGAACTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCGGGCGGCGGCTTCGGCGGCGTG
CAGATCCCGCGCATCGGCGATGAGGTGGTGGTCGATTTCCTGAACGGCGACCCCGATCAGCCGATCGTGA
CGGGGCGCGTGTACAACGGCGAGAAGATGCCGCCATGGGGGCTGCCCGGCAGCGCGACACAAAGCGGGCT
GCTGTCGCGCTCGTCGCCGGGCGGCACGGCCGAGCATTCGAACGCGTTTCGCTTCGAGGACAAGAAGGGC
GCGGAGCAGCTGTGGATGCATGCGGAGCGCAACTTCGACGCGGAGACTGAGCAGGACCACACGCTGTCGG
TGGGCCACGATCATTCGCATTCGGTCGGCAACAACGAGATGATGAGCGTCGCGAACGACCGGCAAAGGAG
CGTCGGGCAGAACGAGACGGTGAACATCGGGAAACATCGCGTCGCGCAGATCGGCGGGAACGAGACGCAT
GGCGTCGCGGGAAACCGCACGCGGCAGGTCGGACAGAACGAAGCCGTGACGATCGGCGCGAATCGCGAGG
CGACGATCGGCGGCAATCACGTGGAGACGGTCGCGAAAGACAAGACCGAAACGATTGGGCAGGGCAAGAC
GCTGAATGTCACTCAGCACTATCAGACGACTTCGAAGAGCATGAAGACCGCTGTCGCCGAACATCACGCC
GAGGAGATCGGCTCGCGAACGTCGACGATCGAGAAAGCGCACGAGCTCAACGTTGGCGGTTCTCAATCGG
TGAACGTTGGCGCGAGCCACACGATGAGCGTGAAGAACAACGTACATGTCGGCGCGGGCGATCAGATCTC
GCTCGTTTGCGGCGATGCGAGCATCACGCTGAAGAAGGACGGCACGATCGCGATCAACGGCGTCACGGTG
GAATCGAGCGCCAGCGGAAGCCATAGCGTGCGCGGCAAGACAGTGACGTCGTCGGCGACGGGCGAGCACA
CGGTGGAAGGCACGATACTGAAACTGAACCCCTGA